SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000011531 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000011531
Domain Number 1 Region: 433-557
Classification Level Classification E-value
Superfamily Cadherin-like 2.86e-26
Family Cadherin 0.0022
Further Details:      
 
Domain Number 2 Region: 221-341
Classification Level Classification E-value
Superfamily Cadherin-like 4.85e-26
Family Cadherin 0.001
Further Details:      
 
Domain Number 3 Region: 333-437
Classification Level Classification E-value
Superfamily Cadherin-like 1.1e-21
Family Cadherin 0.0017
Further Details:      
 
Domain Number 4 Region: 118-225
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-21
Family Cadherin 0.0034
Further Details:      
 
Domain Number 5 Region: 549-656
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000108
Family Cadherin 0.0034
Further Details:      
 
Domain Number 6 Region: 21-90
Classification Level Classification E-value
Superfamily Cadherin-like 0.00002
Family Cadherin 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000011531   Gene: ENSNLEG00000009454   Transcript: ENSNLET00000012096
Sequence length 963
Comment pep:known_by_projection supercontig:Nleu1.0:GL397305.1:8312457:8419060:1 gene:ENSNLEG00000009454 transcript:ENSNLET00000012096 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVGWGVAVLCLWVSCGAAAGQLEYSVPEETERGVAVGNVAADLRLPAAAMSSRNFRFLSS
HRELYFGVDLPSGNLVVREPADRERLCRAKAACVLTYDLVLEDPLELHKIRVHVLDTNDN
SPLFPAGDVQLHIPEFLTPGARFTLPNAQDDDEGSNGILNYSLSPSQHFRLDMGSRVDGS
EYPELVLEKALDREQRATHLLVLTARDGGLPARSGEAQVTIIVVDTNDNAPVFECSVYRT
KVPETAPNGTVLFRVQALDPDEGSNGEVRYSLSNSTQAELRHRFHVHPKSGEVQVAASLG
PPETLLEAYIEARDEGVFGLASTAKLLVEVTDVNDHAPELDFMTLSNPVPEDAAPGTVIA
LFSVKDEDLDSNGRVICGMSSAGPFQLTASFDNYYSLLIDGPLDREQISEYQVLIMASDS
GSPPLSTRRTITVSVADVNDNTPSFPQPQQELFVAENNGPGASLGRVFAQDPDLGKNGLV
SYELLDVISEGPPASSLVAVESSSGAITAKTSFDFEQLRGFRFQVEGRDGGIPPRSATVT
INLFVVDRNDNYPVILFPLPRNGSVPVEIVPRSARTGHLVTKVVAEDADSGSNAWLSYHI
SRSSDSSLFRISANIGELRTARLVLPADAVKQRVVVVVRDHGDPPLSSSVTLGVLLSNSV
PQLLPDFEDVWEPGGQLSAQNLYLVIALACISFLFLGCLLFFVCTKLHQSPGCCPQSCCH
STEDLRYGRKMVSNPCMTSATIDVTTVERLSQTYLYRASLGLGSDNNSLLLRGEYNAADL
RNLAPGVGLNLPISCIQIRNRKGDHANVNAMPRQPNPDWRYSASLRAGMHSSVHLEEAGI
LRAGPGGPDQQWPTVSSATPEPEAGEVSPPVGAGVNSNSWTFKYGPGNPKQSGPGELPDK
FIIPGSPAIISIRQEPTNSQIDKSDFITFGKKEETKKKKKKKKGNKTQEKKEKGNSTTDN
SDQ
Download sequence
Identical sequences ENSNLEP00000011531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]