SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000011534 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000011534
Domain Number 1 Region: 230-369
Classification Level Classification E-value
Superfamily Cadherin-like 2.75e-30
Family Cadherin 0.0014
Further Details:      
 
Domain Number 2 Region: 442-568
Classification Level Classification E-value
Superfamily Cadherin-like 5.63e-29
Family Cadherin 0.0026
Further Details:      
 
Domain Number 3 Region: 127-234
Classification Level Classification E-value
Superfamily Cadherin-like 3.01e-23
Family Cadherin 0.003
Further Details:      
 
Domain Number 4 Region: 558-669
Classification Level Classification E-value
Superfamily Cadherin-like 5.57e-17
Family Cadherin 0.0021
Further Details:      
 
Domain Number 5 Region: 343-446
Classification Level Classification E-value
Superfamily Cadherin-like 2.49e-16
Family Cadherin 0.006
Further Details:      
 
Domain Number 6 Region: 30-110
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000871
Family Cadherin 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000011534   Gene: ENSNLEG00000009485   Transcript: ENSNLET00000012100
Sequence length 813
Comment pep:known_by_projection supercontig:Nleu1.0:GL397305.1:8231899:8234430:1 gene:ENSNLEG00000009485 transcript:ENSNLET00000012100 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVYHWRGDLGSRRLLLSLLLLAAWKVGRGQLHYSVPEEAKHGTFVGRIAQDLGLELAELV
PRLFRVASKTHGDLLEVNLQNGILFVNSRIDREELCGRSAECSIHLEVIVDRPLQVFHVD
VEVKDINDNPPVFRVKEQKLFVSESRMPDSRFPLEGASDADVGANSVLTYRLSSHDYFLL
DVNSKNDENKQVELVLRKSLDREEAPAHNLFLTATDGGKPELTGTVQLLVTVLDVNDNAP
TFEQSEYEVRIFENADNGTTVIRLNASDRDEGSNGAISYSFNSLVEPMVIDHFSIDRNTG
EIVIRGNLDFEQVNLYKRIDATDKGHPPMAGHCTVLVRILDKNDNVPEIALTSLSLPVRE
DAQFGTVIALISVNDLXXXXXXXXXXXXXXXXPFKLVSTFKNYYSLVLDSALDRESVSAY
ELVVTARDEGSPSLWATASVSVEVADVNDNAPAFAQSEYTVFVKENNPPGCHIFTVSARD
ADAQENALVSYSLVERRVGERSLSSYVSVHAESGKVYALQPLDREDLELLQFQVSARDAG
MPPLGSNVTLQVFVLDENDNAPALLEPRVGGTGGTVSELVPRSVGAGQVVAKVRAVDPDS
GYNAWLSYELQPAASSSRIPFRVGLYTGEISTTRVLDEADSPRHCLLVLVKDHGEPALTA
TATVLVSLVESGQAPKASSRQLAGVVGPEAALVDVNVYLIIAICAVSSLLVLTLLLYTAL
RCSALPTEGGCPAGKPTLVCSSAVGSWSHSRQQPQRLCSGEGPLKTDLMAFSPSLPPDLG
SVDVGEEQDLNVGHGLKVSPFKFRTHKFYLWKL
Download sequence
Identical sequences ENSNLEP00000011534 ENSNLEP00000011534

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]