SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000011538 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000011538
Domain Number 1 Region: 438-570
Classification Level Classification E-value
Superfamily Cadherin-like 1.31e-29
Family Cadherin 0.001
Further Details:      
 
Domain Number 2 Region: 235-361
Classification Level Classification E-value
Superfamily Cadherin-like 2.36e-29
Family Cadherin 0.0017
Further Details:      
 
Domain Number 3 Region: 339-443
Classification Level Classification E-value
Superfamily Cadherin-like 6e-22
Family Cadherin 0.0034
Further Details:      
 
Domain Number 4 Region: 127-221
Classification Level Classification E-value
Superfamily Cadherin-like 6.14e-18
Family Cadherin 0.003
Further Details:      
 
Domain Number 5 Region: 554-663
Classification Level Classification E-value
Superfamily Cadherin-like 3.57e-17
Family Cadherin 0.0029
Further Details:      
 
Domain Number 6 Region: 31-96
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000157
Family Cadherin 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000011538   Gene: ENSNLEG00000009491   Transcript: ENSNLET00000012106
Sequence length 795
Comment pep:known_by_projection supercontig:Nleu1.0:GL397305.1:8567218:8585186:1 gene:ENSNLEG00000009491 transcript:ENSNLET00000012106 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METALAKTPQKRQVMFLAILLLLWEAGSEAVRYSIPEETESGYSVANLAKDLGLGVGELA
TRGARIHYKGNKELLQLDIKTGNLLLYEKLDREVMCGATEPCILHFQVLLENPVQFFQTD
LQLTDINDHSPEFPEREMLLKIPESTQPGTVFPLKIAQDLDIGSNTVQNYTISPNSHFHV
AMHNRGDGRKYPELVLDKALDREEWPELSLTLTALDGGARPGXXXXXXXXXXXXXNDNAP
EFLQSLYEVQVSENSPLNSLVVVVSARDLDAGAYGSVAYVLFQGDEVTQPFVIDEKTGEI
RLKRALDFEATPYYNVEIVATDGGGLSGKCTVAIEVVDVNDNAPELTMSTLSSPTPENAP
ETVVAVFSVSDPDSGDNGRMICSIQNDLPFLLKPTLKNFYTLVTQRTLDRESQAEYNITI
TVTDLGTPRLKTEYNITVLVSDVNDNAPVFTQTSYTLFVRENNSPALHIGSVSATDRDSG
TNAQVTYSLLLPQDPHLPLASLVSINADNGHLFALRSLDYEALQAFEFHVGATDRGSPAL
SSEALVRVLVLDANDNSPFVLYPLQNGSAPCTELVPRAAEPGYLVTKVVAVDGDSGQNAW
LSYQLLKATEPGLFGVWAHNGEVRTARLLSERDAAKHRLVVLVKDNGEPQRSATATLHVL
LVDGFSQPYLPLPEAAPARAQADSLTVYLVVALASVSSLFLFSVLLFVAVRLCRRSRAAS
VGRCSVTEGPFPGHLVDVSGTGTLSQSYQYEVCLTGDSGAGEFKFLKPIIPNLLPQGAGE
EIGKTAAFGNSFGLN
Download sequence
Identical sequences ENSNLEP00000011538 ENSNLEP00000011538

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]