SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000011546 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000011546
Domain Number 1 Region: 1552-1851
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.13e-62
Family Protein kinases, catalytic subunit 0.00000308
Further Details:      
 
Domain Number 2 Region: 2944-3190
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.31e-44
Family Protein kinases, catalytic subunit 0.00015
Further Details:      
 
Domain Number 3 Region: 1240-1343,2625-2721
Classification Level Classification E-value
Superfamily Fibronectin type III 5.69e-22
Family Fibronectin type III 0.0014
Further Details:      
 
Domain Number 4 Region: 1441-1535
Classification Level Classification E-value
Superfamily Immunoglobulin 5.89e-22
Family I set domains 0.0011
Further Details:      
 
Domain Number 5 Region: 826-919
Classification Level Classification E-value
Superfamily Immunoglobulin 7.23e-22
Family I set domains 0.0062
Further Details:      
 
Domain Number 6 Region: 678-771
Classification Level Classification E-value
Superfamily Immunoglobulin 1.02e-21
Family I set domains 0.013
Further Details:      
 
Domain Number 7 Region: 1030-1118
Classification Level Classification E-value
Superfamily Immunoglobulin 4.77e-21
Family I set domains 0.0013
Further Details:      
 
Domain Number 8 Region: 1147-1239
Classification Level Classification E-value
Superfamily Immunoglobulin 1.33e-18
Family I set domains 0.024
Further Details:      
 
Domain Number 9 Region: 2538-2630
Classification Level Classification E-value
Superfamily Immunoglobulin 2.24e-18
Family I set domains 0.019
Further Details:      
 
Domain Number 10 Region: 5-90
Classification Level Classification E-value
Superfamily Immunoglobulin 4.35e-18
Family I set domains 0.0056
Further Details:      
 
Domain Number 11 Region: 929-1013
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000368
Family I set domains 0.012
Further Details:      
 
Domain Number 12 Region: 1348-1445
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000462
Family I set domains 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000011546   Gene: ENSNLEG00000009468   Transcript: ENSNLET00000012117
Sequence length 3221
Comment pep:known_by_projection supercontig:Nleu1.0:GL397345.1:1319588:1378451:1 gene:ENSNLEG00000009468 transcript:ENSNLET00000012117 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VAGTPVFLRRLKNAAVCAGSDVRLRVVVSGTPQPSLRWFRDGQLLPAPAPEPSCLWLRRC
GAQDAGVYSCTAQNERGRASCEAVLTVLEVGAKHETHSRLSGNSGVEVLILLSSGPGCTR
PMGGHVGMLWTSACPPPIDFQVQCEEKAEAWGQGMGILNMREGSGGGRRREGAGRPGRPG
GRAGHRSWARFPSSGAPESNAHGSALSSIYSPSPALDVYVLGLSLYQDPAISPIFSVPQS
GLRREEPDLQPQLASEAPRRPAQPPPSKSALLPPPSPRVGKRSPPGPPAQPVATPTSPHR
RTQEPVLPEDTTTEEKRGKKSKSSGPSLAGTAESRPQTPLSEASGRLSALGRSPRLVRAG
SRILDKLQFFEERRRSLERSDSPPAPLRPWVPLRKARSLEQPKSERGAPWGTPGASQEEL
RAPGSVAERRLLFQQKAASLDERTRQRSPASDLELRFAQELGRIRRSTSREELVRSHESL
RATLQRAPSPREPGEPPLFSRPSTPKTSRAVSPAAAAQPPSPSSAGKPGDEPGRPRSRGP
AGRTEPGEGPQQEVRRRDQFPLTRSRAIQECRSPVPPPAADLPEARTKAPPGRKREPPAQ
AVRFLPWATPGLEGTAVPQTLEKNRAGQRELRRGEEDGPWPWDRRGARSQGKGRRARPTS
PELESSDDSYVSAGEEPLEAPVFEIPLQNVVVAPGADVLLKCIVTANPLPQVSWHKDGSA
LRSEGRLLLRAEGERHTLLLREARAADTGSYMATATNELGQATCAASLTVRPGGSTSPFS
SPITSDEEYLSPPEEFPEPGETWPRTPTMKPSPSQNRRSSDTGSKAPPTFKVSLMDQSVR
EGQDVIMSIRVQGEPKPVVSWLRNRQPVRPDQRRFAEEAEGGLCRLRILAAERGDAGFYT
CKAVNEYGARQCEARLEVRAHPESRSLAVLAPLQDVDVGAGEMALFECLVAGPTDVEVDW
LCRGRLLQPALLKCKMHFDGRKCKLLLTSVHEDDSGVYTCKLSTAKGDWRCTVRCPGNGA
PTPRGRGVGEYVEVLEGRAARFDCKISGTPPPVVTWTHFGRPMEESENLRLRQDGGLHSL
HIAHVGSEDEGLYAVSAVNTHGQAHCSAQLYVEEPRTAASGPSSKLEKMPSIPEEPEQGE
LERLSIPDFLRPLQDLEVGLAKEAMLECQVTGLPYPTISWFHNGHRIQSSDDRRMTQYRD
VHRLVFPAVGPQHAGVYKSVIANKLGKAACYAHLYVTDVVPGPPDGAPQVVAVTGRMVTL
TWNPPRSLDMAIDPDSLTYTVQHQVLGSDQWTALVTGLREPGWAATGLRKGVQHIFRVLS
TTVKSSSKPSPPSEPVQLLEHGPPLEEAPAVLDKPDIVYVVEGQPASVTVTFNHVEAQVV
WRSCRGALLEARAGVYELSQPDDDQYCLRICRVSRRDMGALTCTARNRHGTQTCSVTLEL
AEAPRFESIMEDVEVGAGETARFAVVVEGKPLPDIMWYKDEVLLTESSHVSFVYEENECS
LVVLSTGAQDGGVYTCTARNLAGEVSCKAELAVHSAQTAMEVEGIGEDEDHRGRRLSDFY
DIHQEIGRGAFSYLRRVVERSSGLEFAAKFIPSQAKPKASARREARLLARLQHDCVLYFH
EAFERRRGLVIVTELCTEELLERMARKPTVCESEIRGYMRQVLEGIHYLHQSHVLHLDVK
PENLLVWDGAVGEEQVRICDFGNAQELTPGEPQYCQYGTPEFVAPEIVNQSPVSGVTDIW
PVGVVAFLCLTGISPFVGENDRTTLMNIRNYNVAFEETTFLSLSREARGFLIKVLVQDQL
RPTAEETLEHPWFKTQAKGAEVSTDHLKLFLSRRRWQRSQISYKCHLVLRPIPELLRAPP
ERVWVTMPRRPPPSGGLSSSSDSEEEELEELPSVPRPLQPEFSGSRVSLTDIPTEDEALG
TPETGAATPMDWQEQGRAPSQDQEAPSPEALPSPGQEPAAGASPRRGELRRGSSAESALP
RAGPREPGRGLHKAASVELPQRRSPSPGATRLARGGLGEGEYAQRLQALRQRLLRAGPEE
GKVSGLRGPLLESLGGRARDPRMARAASSEAAPHHQPPLENRGLQKSSSFSQGEAEPRGR
HRRAGAPLEIPVARLGARLQESPSLSALSEAQPSSPARPSGPKPSAPKSAEPSATTPSDA
PQPPAPQPDQDKAPEPRPEPVQASKPAPPAEALKTLALPLTPYAQIIQSLQLSGHAQGPP
QGPAAPPSEPKPHAAVFARVASPPPGAPEKRVPSAGGPPVLAEKTRVPTVPPRPGSSLSS
SIENLESEAVFEAKFKRSRESPLSLGLRLLSRSRSEERPFAGAEEEDGIYRPSPAGTPEL
VRRPERSRSVQDLRAVGEPGLVRRLSLSLSQRLRRTPPAQRHPAWEARGGDGESSEGGSS
ARGSPVLAMRRRLSSTLERLSSRLQRSGSSEDSGGASGRSTPLFGRLLRATSEGESLRRL
GLPHNQLAAQASATTPSAESLGSEASATSGSSAPGESRSQLRWGFSRPRKDKGLSPPNLS
ASVQEALGHQYVRSESDFPPVFHIKLKDQVLLEGEAATLLCLPAACPAPHISWMKDKKSL
RSEPSVIIVSCKDGRQLLSIPRAGKWHAGLYECSATNVLGSITSSCTVAVARVPGKLAPP
EVPQTYQDTALVLWKPGDSRAPCTYTLERRVDGESVWHPVSSGIPDCYYNVTHLPVGVTV
RFRVACANRAGQGPFSNPSEKVFVRGTQDSSAVPSATHQEAPVTSGPARAPPPDSPTSLA
PPLAPAAPTPPSVTVSPSSPPTSPSQALSSLKAVGPPPQTPPRRHRGLQAARPTEPTLPS
THVTPSEPRSFVLDTGTPTPASTPQGVKPVSSSTPVYVVTSFVSAPPAPEPPAPEPPPEP
TKVTVRSLSPAKEVVSSPGSSPRSSPRPEGTTLRQGPPQKPYTFLEEKARQAGLGKGRGQ
RGNATGRTFVAKIVPYAAEGKRRVLQEYEVLRTLHHERIMSLHEAYITPRYLVLIAESCG
NRELLCGLSDRFRYSEEDVATYVVQLLQGLDYLHGRHVLHLDIKPDNLLLAPDNALKIVD
FGSAQPYNPQALRPLGHRTGTLEFMGEGTSCQPGGSSQGSPHFTYICVLIGRSPFYEPDP
QETEARIVGGRFDAFQLYPNTSQSATLFLRKVLSVHPWSRPSLQDCLAHPWLQDAYLMKL
RRQTLTFTTNRLKEFLGEQRRRRAEAATRHKVLLRSYPGGP
Download sequence
Identical sequences ENSNLEP00000011546 ENSNLEP00000011546

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]