SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000011547 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000011547
Domain Number 1 Region: 230-360
Classification Level Classification E-value
Superfamily Cadherin-like 8.77e-32
Family Cadherin 0.00056
Further Details:      
 
Domain Number 2 Region: 439-572
Classification Level Classification E-value
Superfamily Cadherin-like 2.9e-29
Family Cadherin 0.00096
Further Details:      
 
Domain Number 3 Region: 127-234
Classification Level Classification E-value
Superfamily Cadherin-like 2.09e-22
Family Cadherin 0.0041
Further Details:      
 
Domain Number 4 Region: 340-444
Classification Level Classification E-value
Superfamily Cadherin-like 1.71e-19
Family Cadherin 0.0031
Further Details:      
 
Domain Number 5 Region: 555-664
Classification Level Classification E-value
Superfamily Cadherin-like 9.67e-18
Family Cadherin 0.0032
Further Details:      
 
Domain Number 6 Region: 30-96
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000228
Family Cadherin 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000011547   Gene: ENSNLEG00000009494   Transcript: ENSNLET00000012118
Sequence length 793
Comment pep:known_by_projection supercontig:Nleu1.0:GL397305.1:8620399:8660041:1 gene:ENSNLEG00000009494 transcript:ENSNLET00000012118 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEARVERAVQKRQVLFLCVFLGMSWAGAEPLQYFVAEETERGTFLTNLAKDLGLGVGELR
ARGTRIVSDQNMQFLLLSSLTGDLLLNEKLDREELCGPREPCVLPFQLLLEKPFQIFRAE
LWVRDINDHSPVFLDREISLKILESTTPGAAFLLESAQDSDVGTNSLSNYTISPNAYFHI
NVHDSGEGNIYPELVLNQVLDREEIPEFSLTLTALDGGSPPRSGTALVRILVLDINDNAP
DFVRSLYKVQVPENSPVGSMVVSVSARDLDTGSNGEIAYAFSYATERILKTFQINPTSGN
LHLKAELDYEAIQTYTLTIQAKDGGGLSGKCTVVVEVTDINDNRPQLLLSSLTSPVEENS
PETVVAVFRIRDRDSGNNGKTVCSIQEDLPFILKPSVENFYTLVAEKPLDRERNTEYHIT
ITVTDLGTPRLKTEYNITVLVSDVNDNAPAFTQTSYTLFVRENNSPALHIGSVSATDRDS
GTNAQVTYSLLPPQDPHLPLPSLVSINADNGHLFALRSLDYEALQAFEFRVGATDRGSPA
LSSEALVRVLVLDANDNSPFVLYPLQNGSAPCTELVPRAAEPGYLVTKVVAVDGDSGQNA
WLSYQLLKATEPGLFGVWAHNGEVRTARLLSERDVAKHRLVVLVKDNGEPPRSATATLHV
LLVDGFSQPYLPLPETAPAQADSLTVYLVVALASVSSLFLFSVLLFVAVRLCRRSRAAPV
GRCSVPEGPFPGHLVDVSGTGTLSQSYQYEVCLTGGSGSNDFKFLKPIIPNFLPQSTGRE
VEENAPFQNNLGF
Download sequence
Identical sequences ENSNLEP00000011547 ENSNLEP00000011547

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]