SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000011548 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000011548
Domain Number 1 Region: 2142-2272
Classification Level Classification E-value
Superfamily Cadherin-like 1.16e-34
Family Cadherin 0.00099
Further Details:      
 
Domain Number 2 Region: 3956-4162
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.48e-33
Family Laminin G-like module 0.006
Further Details:      
 
Domain Number 3 Region: 238-357
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-30
Family Cadherin 0.00054
Further Details:      
 
Domain Number 4 Region: 2663-2773
Classification Level Classification E-value
Superfamily Cadherin-like 2.86e-29
Family Cadherin 0.00036
Further Details:      
 
Domain Number 5 Region: 1309-1412
Classification Level Classification E-value
Superfamily Cadherin-like 3.4e-29
Family Cadherin 0.0017
Further Details:      
 
Domain Number 6 Region: 1204-1315
Classification Level Classification E-value
Superfamily Cadherin-like 1.31e-28
Family Cadherin 0.00036
Further Details:      
 
Domain Number 7 Region: 463-585
Classification Level Classification E-value
Superfamily Cadherin-like 2.14e-28
Family Cadherin 0.00083
Further Details:      
 
Domain Number 8 Region: 682-785
Classification Level Classification E-value
Superfamily Cadherin-like 2.75e-28
Family Cadherin 0.0011
Further Details:      
 
Domain Number 9 Region: 4179-4401
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.17e-28
Family Laminin G-like module 0.0014
Further Details:      
 
Domain Number 10 Region: 1933-2056
Classification Level Classification E-value
Superfamily Cadherin-like 3.71e-28
Family Cadherin 0.00049
Further Details:      
 
Domain Number 11 Region: 3393-3514
Classification Level Classification E-value
Superfamily Cadherin-like 7.72e-28
Family Cadherin 0.0014
Further Details:      
 
Domain Number 12 Region: 2046-2147
Classification Level Classification E-value
Superfamily Cadherin-like 1.21e-27
Family Cadherin 0.0011
Further Details:      
 
Domain Number 13 Region: 3083-3194
Classification Level Classification E-value
Superfamily Cadherin-like 3.14e-27
Family Cadherin 0.00074
Further Details:      
 
Domain Number 14 Region: 1408-1536
Classification Level Classification E-value
Superfamily Cadherin-like 4.71e-27
Family Cadherin 0.0013
Further Details:      
 
Domain Number 15 Region: 3182-3292
Classification Level Classification E-value
Superfamily Cadherin-like 6.85e-27
Family Cadherin 0.0012
Further Details:      
 
Domain Number 16 Region: 881-988
Classification Level Classification E-value
Superfamily Cadherin-like 6.94e-27
Family Cadherin 0.003
Further Details:      
 
Domain Number 17 Region: 1835-1944
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-26
Family Cadherin 0.0011
Further Details:      
 
Domain Number 18 Region: 984-1092
Classification Level Classification E-value
Superfamily Cadherin-like 3.14e-26
Family Cadherin 0.00092
Further Details:      
 
Domain Number 19 Region: 2352-2458
Classification Level Classification E-value
Superfamily Cadherin-like 6e-26
Family Cadherin 0.00061
Further Details:      
 
Domain Number 20 Region: 575-681
Classification Level Classification E-value
Superfamily Cadherin-like 1.37e-24
Family Cadherin 0.001
Further Details:      
 
Domain Number 21 Region: 2253-2364
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-24
Family Cadherin 0.0014
Further Details:      
 
Domain Number 22 Region: 1733-1834
Classification Level Classification E-value
Superfamily Cadherin-like 5.37e-24
Family Cadherin 0.0009
Further Details:      
 
Domain Number 23 Region: 2860-2982
Classification Level Classification E-value
Superfamily Cadherin-like 1.34e-23
Family Cadherin 0.0023
Further Details:      
 
Domain Number 24 Region: 2977-3080
Classification Level Classification E-value
Superfamily Cadherin-like 2.22e-23
Family Cadherin 0.0011
Further Details:      
 
Domain Number 25 Region: 2454-2565
Classification Level Classification E-value
Superfamily Cadherin-like 9.95e-23
Family Cadherin 0.0041
Further Details:      
 
Domain Number 26 Region: 2767-2865
Classification Level Classification E-value
Superfamily Cadherin-like 2.22e-22
Family Cadherin 0.0016
Further Details:      
 
Domain Number 27 Region: 788-893
Classification Level Classification E-value
Superfamily Cadherin-like 3.14e-22
Family Cadherin 0.0015
Further Details:      
 
Domain Number 28 Region: 1088-1204
Classification Level Classification E-value
Superfamily Cadherin-like 2.14e-21
Family Cadherin 0.003
Further Details:      
 
Domain Number 29 Region: 3292-3397
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-20
Family Cadherin 0.0021
Further Details:      
 
Domain Number 30 Region: 3503-3606
Classification Level Classification E-value
Superfamily Cadherin-like 5.23e-20
Family Cadherin 0.0018
Further Details:      
 
Domain Number 31 Region: 2564-2669
Classification Level Classification E-value
Superfamily Cadherin-like 2.86e-19
Family Cadherin 0.0038
Further Details:      
 
Domain Number 32 Region: 129-250
Classification Level Classification E-value
Superfamily Cadherin-like 9.57e-19
Family Cadherin 0.0023
Further Details:      
 
Domain Number 33 Region: 346-467
Classification Level Classification E-value
Superfamily Cadherin-like 2.71e-16
Family Cadherin 0.0013
Further Details:      
 
Domain Number 34 Region: 1517-1623
Classification Level Classification E-value
Superfamily Cadherin-like 3e-16
Family Cadherin 0.0023
Further Details:      
 
Domain Number 35 Region: 3849-3975
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000369
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 36 Region: 1627-1732
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000103
Family Cadherin 0.002
Further Details:      
 
Domain Number 37 Region: 68-135
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000228
Family Cadherin 0.0078
Further Details:      
 
Domain Number 38 Region: 4428-4465
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000203
Family EGF-type module 0.014
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000011548
Domain Number - Region: 3608-3698
Classification Level Classification E-value
Superfamily Cadherin-like 0.00171
Family Cadherin 0.057
Further Details:      
 
Domain Number - Region: 3803-3861
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0056
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000011548   Gene: ENSNLEG00000009479   Transcript: ENSNLET00000012119
Sequence length 4981
Comment pep:known_by_projection supercontig:Nleu1.0:GL397336.1:10569559:10744406:1 gene:ENSNLEG00000009479 transcript:ENSNLET00000012119 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLAPDRATARPWLPLHTLSVSQLLRVFWLLSLLPGQAWVYGAEQRQVFQVLEEQPPGTL
VGTIQTRPGFTYRLSESHALFAINSSTGALYTTSTIDHESLPSDVINLVVLSSAPTYPTE
VRVLVRDLNDNAPVFPDPSIVVTFKEDSSSGRQVILDTATDSDIGSNGVDHRSYRIIRGN
EAGRFRLDITLNPSGEGAFLHLVSKGGLDREVTPQYQLLVEVEDKGEPKRRGYLQVNVTV
QDINDNPPVFGSSHYQAGVTEDAVVGSSVLQVAAADADEGTNADIRYRLQDEGTPFQMDP
ETGIITVREPLDFEARRQYSLTVQAMDRGVPSLTGRAEALIQLLDVNDNDPVVKFRYFPA
TSRYASVDENAQVGTVVALLTVTDADSPAANGNISVQILGGNEQRHFEVQSSKVPNLSLI
KVASALDRERIPSYNLTVSVSDNYGAPPGAAVQARSSVASLVIFVNDINDHPPVFSQQVY
RVNLSEEAPPGSYVSGISATDGDSGLNANLRYSIVSGNGLGWFHISEHSGLVTTGSSGGL
DRELASQIVLNISARDQGVHPKVSYARLVVTLLDVNDEKPLFSQPEGYDVSVVENAPTGT
ELLMLRATDGDLGDNGTVRFSLQEAETDRRSFRLDPVSGRLSTISSLDREEQAFYSLLVL
ATDLGSPPQSSMARINVSLLDINDNSPVFYPVQYFAHIKENEPGGSYITTVSATDPDLGT
NGTVKYSISAGDRSRFQVNAQSGVISTRMALDREEKTAYQLQIVATDGGNLQSPNQAIVT
ITVLDTQDNPPVFSQVAYSFVVFENVALGYHVGSVSASTMDLNSNISYLITTGDQKGMFA
INQVTGQLTTANVIDREEQSFYQLKVVASGGTVTGDTMVNITVKDLNDNSPHFLQAIESV
NVVENWQAGHSIFQAKAVDPDEGVNGMVLYSLKQNPKNLFAINEKNGTISLLGPLDVHAG
SYQIEILASDMGVPQLSSSVILTVYVHDVNDNSPVFDQLSYEVTLSESEPVNSRFFKVQA
SDKDSGANGEIAYTIAEGNTGDAFGIFPDGQLYIKSELDRELQDRYVLMVVASDRAVEPL
SATVNVTVILEDVNDNRPLFNSTNYTFYFEEEQRAGSFVGKVSAVDKDFGPNGEVRYSFE
MVQPDFELHAISGEITNTHQFDRESLMRRRGTAVFSFTVIATDQGLPQPLKDQATVHVYM
KDINDNAPKFLKDFYQATISESAANLTQVLRVSASDVDEGNNGLIHYSIIKGNEERQFAI
DSTSGQVALTGKLDYEATPAYSLVIQAVDSGTIPLNSTCTLNIDILDENDNTPSFPKSTL
FVDVLENMRIGELVSSVTATDSDSGDNADLYYSITGTNNHGTFSISPNTGSIFLAKKLDF
ETQSLYKLNITAKDQGRPPRSSTMSVVIHVRDFNDNPPSFPPGDIFKSVVENIPIGTSVI
SVTAHDPDADINGQLSYTIIQQMPRGNHFTIDEVKGTIYTNAEIDREFANLFELTVKAND
QAVPIETRRYALKNVTILVTDLNDNVPMFISQNALAADPSAVIGSVLTTIMAADPDEGAN
GEIEYEIINGDTDTFIVDRYSGDLRVASALVPSQLIYNLIVSATDLGPERRKSTTELTII
LQGLDGPVFTQPKYITILKEGEPIGTNVISIEAASPRGSEAPVEYYIVSVRCEEKTVGRL
FTIGRHTGIIQTAAILDREQGACLYLVDVYAIEKSTAFPRTQRAEVEITLQDINDNPPVF
PTDMLDLTVEENIGDGSKIMQLTAMDADEGANALVTYTIISGADDSFRIDPESGDLIATR
RLDRERRSKYSLLVRADDGLQSSDMRINITVSDVNDHTPKFSRPVYSFDIPEDTIPGSLV
AAILATDDDSGVNGEITYIVNEDDEDGIFFLNPITGVFNLTRLLDYEVQQYYILTVRAED
GGGQFTTIRVYFNILDVNDNPPIFSLNSYSTSLMENLPVGSTVLVFNVTDADDGVNSQLT
YSIASGDSLGQFTVDKNGILKVLKALDRESQSFYNLVVQVHDLPQIPASRFTSTAQVSII
LLDVNDNPPTFLSPKLTYIPENTPIDTVVFKAQATDPDSGPNSYIEYTLLNPLGNKFSIG
TIDGEVRLTGELDREEVSNYTLTVVATDKGQPSLSSSTEVVVMVLDINDNNPIFAQALYK
VEINENTLTGTDIIQVFAADGDEGTNGQVRYGIVNGNTNQEFRIDSVTGAITVAKPLDRE
KTPTYHLTVQATDRGSTPRTDTSTVSIVLLDINDFVPIFELSPYSVNVPENLGTLPRTIL
QVVARDDDQGSNSKLSYVLFGGNEDNAFTLSASGELGVTQSLDRETKEHFVLMITATDSG
SPALTGTGTINVIVDDVNDNVPTFASKAYFTTIPEDAPTGTDVLLVNASDADASTNAVIR
IIGGNSQFTINPSTGQIITSALLDRETKDNYTLVVVCSDAGSPEPLSSSTSVLVTVTDVN
DNPPRFQHHPYVTHIPSPTLPGSFVFAVTVTDADIGPNSELHYSLSGRNSEKFHIDPLRG
AIMAAGPLNGASEVTFSVHVKDGGSFPKTDSTTVTVRFVNKADFPKVRAKEQTFMFPENQ
PVSSLVTTITGSSLRGEPMSYYIASGNLGNTFQIDQLTGQVSISQPLDFEKIQKYVVWIE
ARDGGFPPFSSYEKLDITVLDVNDNAPIFKEDPFISEILENLSPRKILTVSAMDKDSGPN
GQLDYEIVNGNMENSFSINHATGEIRSVRPLDREKVSHYVLTIKSSDKGSPSQSTSVKVM
INILDENDNAPRFSQIFSAHVPENSPLGYTVTRVTTSDEDIGINAISRYSIMDTSLPFTI
NPSTGDIVISRPLNREDTDRYRIRVSAHDSGWTVSTDVTIFVTDVNDNAPRFSRPSYYLD
CPELTEIGSKVTQVFAADPDEGSNGQVFYFIKSQSEYFRINATTGEIFNKQILKYQNVTG
FSNVNINRHSFIVTSSDRGKPSLISETTVTINIVDSNDNAPQFLKSKYFTPVTKNVKVGT
KLIKVTAIDDKDFGLNSEVEYFISNDNHLGKFKLDNDTGWISVASSLISDLNQNFFITVT
AKDKGNPPLSSQATVHITVTEENYHTPEFSQSHMSATIPESHSVGSIVRTVSARDRDAAM
NGLIKYSISSGNEEGIFAINSSTGILTLAKALDYELCQKHEMTISAIDGGWVARTGYCSV
TVNVIDVNDNSPVFLSDDYFPTVLENAPSGTTVIHLNATDADSGTNAVIAYTVQSSDSDL
FVIDPNTGVITTQGFLDFETKQSYHLTVKAFNVPDEERCSFATVNVQLKGTNEYVPRFVS
KLYYFEISEAAPKGTIVGEVFASDRDLGTDGEVHYLIFGNSRKKGFQINEKTGQIYVSGI
LDREKEERVSLKVLAKNFGSIRGADIDEVTVNVTVLDANDPPVFTLNIYSVQISEGVPIG
THVTFVSAFDSDSIPSWSRFSYFIGSGNENGAFSINPQTGQITVTAELDRETLPIYNLSV
LAVDSGTPSATGSASLLVTLEDINDNGPMLTVSEGEVMENKRPGTLVMTLQSTDPDLPPN
QGPFTYYLLSTGPATSYFSLSTAGVLSTTREIDREQIADFYLSVVTKDSGVPQMSSTGTV
HITVIDQNDNPSQSRTVEIFVNYYGNLFPGGILGSVKPQDPDVLDSFHCSLTSGVTSLFS
IPGGTCDLNSQPRSTDGTFDLTVLSNDGVHSTVTSNIRVFFAGFSNATVDNSILLRLGVP
TVKDFLTNHYLHFLRIASSQLTGLGTAVQLYSTYEENNRTFLLAAVKRNHNQYVNPSGVA
TFFESIKEILLRQSGVKVESVDHDSCVHGPCQNGGSCLRRLAVSSLLKSRESLPVIVVAN
EPLQPFLCKCLPGYAGSWCEIDIDECLPSPCHNGGTCHNLVGGFSCSCPDGFTGRACERD
INECLQSPCKNAAVCQNFPGSFNCVCKTGYTGKMCESSVNYCECNPCFNGGSCQSGVDSY
YCHCPFGVFGKHCELNSYGFEELSYMEFPSLDPNNNYIYVKFATIKSHALLLYNYDNQTG
NWAEFLALEIAEERLRFSYNLGSGTYKLTTMKKVSDGHFHTVIARRAGMAASLTVDSCSE
NQEPGYCTVSNVAVSDDWTLDVQPNRVTVGGIRSLEPILQRRGHVESHDFVGCIMEFAVN
GRPLEPSQALAAQGILDQCPRLEGACTRSPCQHGGTCMDYWSWQQCHCKEGLTGKYCEKS
VTPDTALSLEGKGRLDYHMSQNEKREYLLRQSLQVAMLEPFGVNSLEVKFRTRSENGILI
HIQESSNYTTVKIKNGKVHFTSDAGIAGKVERNIPEVYVADGHWHTFLIGKNRTATVLSV
DRIYNRDIIHPTQDFGGLDVLTISLGGIPPNQAHRDAQTAGFDGCIASIWYGGESLPFSG
KHSLASISKTDPSVKIGCRGPNICASNPCWGDLLCINQWYAYRCVPPGDCASHPCQNGGS
CEPGLHSGFTCSCPDSHTGRTCEMVVACLGVLCPQGKVCKAGSPAGHVCVLSQGPEEISL
PLWAVPAIVGSCATVLALLVLSLILCNQCRGKKAKSPKEEKKPKEKKKKGSENVAFDDPD
NIPPYGDDMTVRKQPEGNPKPDIIERENPYLIYDETDIPHNSETIPSAPLASPEQEIEHY
DIDNASSIAPSDADIIQHYKQFRSHTPKFSIQRHSPLGFARQSPMPLGASSLTYQPSYGQ
GLRTSSLSHSACPTPNPLSRHSPAPFSKSSTFYRNSPARELHLPIRDGNTLEMHGDTCQP
GIFNYATRLGRRSKSPQAMASHGSRPGSRLKQPIGQIPLESSPPVGLSIEEVERLNTPRP
RNPSICSADHGRSSSEEDCRRPLSRTRNPADGIPAPESSSDSDSHESFTCSEMEYDREKP
MVYTSRMPKLSQVNESDADDEDNYGARLKPRRYHGRRAEGGPVGTQAAAPGTADNTLPMK
LGQQAGTFNWDNLLNWGPGFGHYVDVFKDLASLPEKAAANEEGKAGTTKPVPKDGEAEQY
V
Download sequence
Identical sequences G1RE98
ENSNLEP00000011548 ENSNLEP00000011548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]