SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000011551 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000011551
Domain Number 1 Region: 44-165
Classification Level Classification E-value
Superfamily Cadherin-like 4.19e-29
Family Cadherin 0.0016
Further Details:      
 
Domain Number 2 Region: 154-258
Classification Level Classification E-value
Superfamily Cadherin-like 1.43e-21
Family Cadherin 0.0054
Further Details:      
 
Domain Number 3 Region: 323-439
Classification Level Classification E-value
Superfamily Cadherin-like 6.54e-20
Family Cadherin 0.0021
Further Details:      
 
Domain Number 4 Region: 254-345
Classification Level Classification E-value
Superfamily Cadherin-like 4.85e-16
Family Cadherin 0.0029
Further Details:      
 
Domain Number 5 Region: 7-56
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000124
Family Cadherin 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000011551   Gene: ENSNLEG00000009502   Transcript: ENSNLET00000012123
Sequence length 547
Comment pep:novel supercontig:Nleu1.0:GL397305.1:8682761:8684524:1 gene:ENSNLEG00000009502 transcript:ENSNLET00000012123 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EGRKYPELVLDQSLDREKESELSLTLTAVDGGSPPRSGTTLINVVVLDINDNAPEFEKPV
YEVHVPESSPLDSLIIKASATDLDAGINGELSYSFSHVSRDVRKTFEIHPISGEVYLKAP
LDFEIIQSYVINIQAIDGGSLSGKSSILVRVVDVNDNPPEIAMTSLTSPIPENSSPEMVV
AVFSIRDQDAGDNGRMVCSIQDNLPFVLKPTFKNFYALVTEHPLDREIRNEYNITITVTD
LGTPRLKTEYNITVLVSDVNDNAPVFTQTSYTLFVRENNSPALHIGSVSATDRDSGTNAQ
ITYSLLPPQDPHLPLASLALVRVLVLDANDNSPFVLYPLQNGSSPCTELVPRGAEPGYLV
TKVVAVDGDSGQNAWLSYQLLKATEPGLFGVWAHNGEVRTARLLSERDAAKHRLVVLVKD
NGEPPRSATATLHVLLVDGFSQPYLPLPEAAPAQAQADSLTVYLVVALASVSSLFLLSVL
LFVAVRLCRRSRAAPVGRCSVPEGPFPGHLVDVSGTGTLSQSYQYEVCLTGGSAANEFKF
LKPIIPN
Download sequence
Identical sequences ENSNLEP00000011551 ENSNLEP00000011551

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]