SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000011557 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000011557
Domain Number 1 Region: 238-305
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00000000000000109
Family Splicing factor U2AF subunits 0.041
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000011557
Domain Number - Region: 169-194
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00034
Family CCCH zinc finger 0.0051
Further Details:      
 
Domain Number - Region: 304-332
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000759
Family CCCH zinc finger 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000011557   Gene: ENSNLEG00000009496   Transcript: ENSNLET00000012130
Sequence length 478
Comment pep:known_by_projection supercontig:Nleu1.0:GL397281.1:13135006:13178529:1 gene:ENSNLEG00000009496 transcript:ENSNLET00000012130 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPEKMTFPEKPSHKKYRAALKKEKRKKRRQELARLRDSGLSQKEEEEDTFIEEQQLEE
EKLLERERQRLHEEWLLREQKAQEEFRIKKEKEEAAKKRQEEQERKLKEQWEEQQRKERE
EEEQKRQEKKEKEEALQKMLDQAENELENGTTWQNPEPPVDFRVMEKDRANCPFYSKTGA
CRFGDRCSRKHNFPTSSPTLLIKSMFTTFGMEQCRRDDYDPDASLEYSEEETYQQFLDFY
EDVLPEFKNVGKVIQFKVSCNLEPHLRGNVYVQYQSEEECQAALSLFNGRWYAGRQLQCE
FCPVTRWKMAICGLFEIQQCPRGKHCNFLHVFRNPNNEFWEANRDIYLSPDRTGSSFGKN
SERRERMGHHDDYYSRLRGRRNPSPDHSYKRNGESERKRSSHRGKKSHKRTSKSRERHNS
RSRGRNRDRSRDHSRGRGSRSRSRRSRRSRSQSSSRSRSRGRRRSGNRDRTVQSPKSK
Download sequence
Identical sequences G1REA7
ENSNLEP00000011557 XP_003261134.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]