SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000011573 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000011573
Domain Number 1 Region: 352-417
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000381
Family IBR domain 0.024
Further Details:      
 
Domain Number 2 Region: 431-485
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000652
Family RING finger domain, C3HC4 0.0091
Further Details:      
 
Domain Number 3 Region: 50-130
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000104
Family Ubiquitin-related 0.011
Further Details:      
 
Domain Number 4 Region: 280-323
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000013
Family RING finger domain, C3HC4 0.03
Further Details:      
 
Domain Number 5 Region: 192-220
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.0000000377
Family Ran binding protein zinc finger-like 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000011573   Gene: ENSNLEG00000009499   Transcript: ENSNLET00000012146
Sequence length 509
Comment pep:known_by_projection supercontig:Nleu1.0:GL397356.1:2535979:2559545:-1 gene:ENSNLEG00000009499 transcript:ENSNLET00000012146 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDEKTKKAEEMALSLTRAVAGGDEQVARKCAIWLAEQRVPLSVQLKPEVSSTQDIRLWVS
VEDAQMHTVTIWLTVRPDMTVASLKDMVFLDYGFPPVLQQWVIGQRLARDQETLHSHGVR
QNGDSAYLYLLSARNTSLNPQELQRERQLRMLEDLGFKDLTLQPRGPLEPGPPKPGVTQE
PGRGQPDAVPEPPPVGWQCPGCTFINKPTRPGCEMCCRARPEAYQVPASYQPDEEERARL
AGEEEALRQYQQRKQQQQEGNYQHVQLDQRSLVLNTEPAECPVCYSVLAPGEAVVLRECL
HTFCRECLQGTIRNSQEAEVSCPFIDNTYSCSGKLLEREIKALLTPEDYQRFLDLGISIA
ENRSAFSYHCKTPDCKGWCFFEDDVNEFTCPVCFHVNCLLCKAIHEQMNCKEYQEDLALR
AQNDVAARQTTEMLKVMLQQGEAMRCPQCQIVVQKKDGCDWIRCTVCHTEICWVTKGPRW
GPGGPGDTSGGCRCRVNGIPCHPSCQNCH
Download sequence
Identical sequences G1REC3
ENSNLEP00000011573 ENSNLEP00000011573

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]