SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000011589 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000011589
Domain Number 1 Region: 407-668
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 7.87e-76
Family Eukaryotic proteases 0.00000000959
Further Details:      
 
Domain Number 2 Region: 10-119
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.2e-30
Family Spermadhesin, CUB domain 0.000000616
Further Details:      
 
Domain Number 3 Region: 167-278
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.93e-28
Family Spermadhesin, CUB domain 0.00000209
Further Details:      
 
Domain Number 4 Region: 349-419
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000848
Family Complement control module/SCR domain 0.000009
Further Details:      
 
Domain Number 5 Region: 283-352
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000181
Family Complement control module/SCR domain 0.0000629
Further Details:      
 
Domain Number 6 Region: 118-164
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000255
Family EGF-type module 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000011589   Gene: ENSNLEG00000009518   Transcript: ENSNLET00000012162
Sequence length 669
Comment pep:known_by_projection supercontig:Nleu1.0:GL397361.1:4595098:4615736:-1 gene:ENSNLEG00000009518 transcript:ENSNLET00000012162 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVPKWPEPVFGRLASPGFPGEYANDQERRWTLTAPPGYRVRLYFTHFDLELSHFCEYDFV
KLSSGAKVLATLCGQESTDTERAPGNDTFYSLSSSLDITFRSDYSNEKPFTGFEAFYAAE
DIDECQVAPGEAPTCDHHCHNHLGGFYCSCRAGYVLHRNKRTCSALCSGQVFTQRSGELS
SPEYPQPYPKLSSCTYSISLEEGFSVILDFVESFDVETHPETLCAYDFLKIQTDREEHGP
FCGKTLPRRIETKSNTVTITFVTDESGDNTGWKIHYTSTAQPCPYPMAPPNGHVSPVQAK
YILKDSFSIFCETGYELLQGHLPLKSFTAVCQKDGSWDQPMPTCSIVDCGPPDDLPSGRV
EYMTGPEVTTYKAVIQYSCEETFYTMQVNDGKYVCEADGFWTSSKGEKSFPVCEPVCGLS
ARTTGGRIYGGQKAKPGDFPWQVLILGGTTAAGALLYDNWVLTAAHAVYEQKHDASSLDI
RMGALKRLSPHYIQAWAEAVFIHEGYTHDAGFDNDIALIKLNNKVVINSNITPICLPRKE
AESFMRTDDIGTASGWGLTQRGFLARNLMYVDIPIVDHQKCTAAYEKPPYPVGSVTANML
CAGLESGGKDSCRGDSGGALVFLDSETQRWFVGGIVSWGSMNCGEAGQYGVYTKVINYIP
WIENIINNF
Download sequence
Identical sequences ENSNLEP00000011589

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]