SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000011606 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000011606
Domain Number 1 Region: 237-365
Classification Level Classification E-value
Superfamily Cadherin-like 1.08e-29
Family Cadherin 0.00086
Further Details:      
 
Domain Number 2 Region: 345-469
Classification Level Classification E-value
Superfamily Cadherin-like 1.08e-24
Family Cadherin 0.0018
Further Details:      
 
Domain Number 3 Region: 450-576
Classification Level Classification E-value
Superfamily Cadherin-like 4.28e-24
Family Cadherin 0.001
Further Details:      
 
Domain Number 4 Region: 134-241
Classification Level Classification E-value
Superfamily Cadherin-like 4.57e-22
Family Cadherin 0.0027
Further Details:      
 
Domain Number 5 Region: 566-672
Classification Level Classification E-value
Superfamily Cadherin-like 8.28e-18
Family Cadherin 0.0016
Further Details:      
 
Domain Number 6 Region: 36-126
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000143
Family Cadherin 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000011606   Gene: ENSNLEG00000009504   Transcript: ENSNLET00000012180
Sequence length 939
Comment pep:novel supercontig:Nleu1.0:GL397305.1:8933806:8971640:1 gene:ENSNLEG00000009504 transcript:ENSNLET00000012180 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLSEMVPEAWRSGLVSTGRVVGVLLLLGALNKASTVIHYEIPEEREKGFAVGNVVANLG
LDLGSLSARRLRVVSGASRRFFEVNRETGEMFVNDRLDREELCGTLPSCTVTLELVVENP
LELFSVEVVIQDINDNNPAFPTQEMKLEISEAVAPGTRFPLESAHDPDVGSNSLQTYELS
RNEYFALRVQTREDSTKYAELVLERALDREREPSLQLVLTALDGGTPALSASLPIHITVL
DANDNAPVFNQSLYRARVLEDAPSGTRVVQVLATDLDEGPNGEIIYSFGSHNRAGVRELF
ALDLVTGMLTIKGRLDFEDTKLHEIYIQAKDKGANPEGTHCKVLVEVVDVNDNAPEITVT
SVYSPVPEDAPLGTVIALLSVTDLDAGENGLVTCEVPPGLPFSLTSSLKNYFTLKTSADL
DRETVPEYNLSITARDAGIPSLSALTIVRVQVSDINDNPPQSSQSSYDVYIEENNLPGAP
ILNLSVWDPDAPQNARLSFFLLEQGAETGLVGRYFTINRDNGIVSSLVPLDYEDRREFEL
TAHISDGGTPVLATNISVNIFVTDRNDNAPQVLYPRPGGSSVEMLPRGTSAGHLVSRVVG
WDADAGHNAWLSYSLLGSPNQSLFAIGLHTGQISTARPVQDTDSPRQTLTVLIKDNGEPS
LSTTATLTVSVTEESPEARAEFPSGSAPREQNKNLTFYLLLSLILVSVGFVVTVSGVIIF
KVYKWKQSRDLYRAPVSSLYRTPGPSLHADAVRGGLMSPHLYHQVYLTTDSRRSDPLLKK
PGAASPLASRQNTLRSCDPVFYRQVLGAESAPPGQQAPPNTDWRFSQAQRPGTSGSQNGD
DTGTWPNNQFDTEMLQAMILASASEAADGSSTLGGAAGTMGLSARYGPQFTLQHVPDYRQ
NVYIPGSNATLTNAAGKRDGKAPAGGNGNKKKSGKKEKK
Download sequence
Identical sequences XP_012360255.1.23891 ENSNLEP00000011606

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]