SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000011693 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000011693
Domain Number 1 Region: 985-1091
Classification Level Classification E-value
Superfamily PDZ domain-like 4.6e-27
Family PDZ domain 0.0000154
Further Details:      
 
Domain Number 2 Region: 763-870
Classification Level Classification E-value
Superfamily PDZ domain-like 1.24e-23
Family PDZ domain 0.00000971
Further Details:      
 
Domain Number 3 Region: 618-721
Classification Level Classification E-value
Superfamily PDZ domain-like 4.21e-22
Family PDZ domain 0.0000166
Further Details:      
 
Domain Number 4 Region: 445-550
Classification Level Classification E-value
Superfamily PDZ domain-like 6.97e-19
Family PDZ domain 0.0000126
Further Details:      
 
Domain Number 5 Region: 1-112
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.18e-17
Family Nucleotide and nucleoside kinases 0.0072
Further Details:      
 
Domain Number 6 Region: 273-377
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000000000146
Family PDZ domain 0.0000171
Further Details:      
 
Domain Number 7 Region: 159-196
Classification Level Classification E-value
Superfamily WW domain 0.000000000000653
Family WW domain 0.0013
Further Details:      
 
Domain Number 8 Region: 206-241
Classification Level Classification E-value
Superfamily WW domain 0.00000000181
Family WW domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000011693   Gene: ENSNLEG00000009605   Transcript: ENSNLET00000012269
Sequence length 1113
Comment pep:known_by_projection supercontig:Nleu1.0:GL397314.1:7930353:8578498:-1 gene:ENSNLEG00000009605 transcript:ENSNLET00000012269 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TTRPHKEGEVPGVDYIFITVEDFMELEKSGALLESGTYEDNYYGTPKPPAEPAPLLLNVT
DQILPGATPSAEGKRKRNKSVSNMEKASIEPPEEEEEERPVVNGNGGVVTPESSEHEDKS
AGASGEMPSQPYPAPVYSQPEELKEQMDDTKPTKPEDNEEPDPLPDNWEMAYTEKGEVYF
IDHNTKTTSWLDPRLAKKAKPPEECKENELPYGWEKIDDPIYGTYYVDHINRRTQFENPV
LEAKRKLQQHNMPHTELGTKPLQAPGFREKPLFTRDASQLKGTFLSTTLKKSNMGFGFTI
IGGDEPDEFLQVKSVIPDGPAAQDGKMETGKVLHGLENCFATSFXXMQMLSTFQSVPIGQ
SVNLVLCRGYPLPFDPEDPANSMVPPLAIMERPPPVMVNGRHNYETYLEYISRTSQSVPD
ITDRPPHSLHSMPADGQLDGTYPPPVHDDNVSMASSGATQAELMTLTIVKGAQGFGFTIA
DSPTGQRVKQILDIQGCPGLCEGDLIVEINQQNVQNLSHTEVVDILKDCPIGSETSLIIH
RGGFFSPWKTPKPIMDRWENQGSPQTSLSAPAIPQNLPFPPALHRSSFPDSTEAFDPRKP
DPYELYEKSRAIYESRQQVPPRTSFRMDSSGPDYKELDVHLRRMESGFGFRILGGDEPGQ
PILIGAVIAMGSADRDGRLHPGDELVYVDGIPVAGKTHRYVIDLMHHAARNGQVNLTVRR
KVLCGGEPCPENGRSPGSVSTHHSSPRSDYATYTNSNHAAPSSNASPPEGFASHSLQTSD
VVIHRKENEGFGFVIISSLNRPESGSTITVPHKIGRIIDGSPADRCAKLKVGDRILAVNG
QSIINMPHADIVKLIKDAGLSVTLRIIPQEELNSPTSAPSSEKQSPMAQQSPLAQQSPLA
QPSPATPNSPVAQPAPPQPLQLQGHENSYRSEVKARQDVKPDIRQPPFTDYRQPPLDYRQ
PPGGDYQQPPPLDYRQPPLLDYRQHSPDTRQYPLSDYRQPQDFDYFTVDMEKGAKGFGFS
IRGGREYKMDLYVLRLAEDGPAIRNGRMRVGDQIIEINGESTRDMTHARAIELIKSGGRR
VRLLLKRGTGQVPEYDPPVPAQAVLLRFRLTAF
Download sequence
Identical sequences ENSNLEP00000011693 ENSNLEP00000011693

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]