SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000011739 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSNLEP00000011739
Domain Number - Region: 10-116
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0326
Family Growth factor receptor domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000011739   Gene: ENSNLEG00000009641   Transcript: ENSNLET00000012316
Sequence length 288
Comment pep:known_by_projection supercontig:Nleu1.0:GL397339.1:8488101:8526051:1 gene:ENSNLEG00000009641 transcript:ENSNLET00000012316 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NYILISFQECRIAHPVVKCTYCRTEYQQESKTNTICKKCAQNVQLYGTPKPCQYCNIIAA
FIGNKCQRCTNSEKKYGPPYSCEQCKQQCAFDRKDDRKKVDGKLLCWLCTLSYKRVLQKT
KEQRKHLSGSSRAGHQEKEQYSRLSGGGHYNSQKTLSTSSIQNEIPKKKSKFESITTNGD
SFSPDLALDSPGTDHFVIIAQLKEEVATLKKMLHQKDQMILEKEKKITELKADFQYQESQ
MRAKMNQMEKTHKEVTEQLQAKNRELLKQAAALSKSKKSEKSGAITSP
Download sequence
Identical sequences ENSNLEP00000011739

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]