SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000011760 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000011760
Domain Number 1 Region: 113-459
Classification Level Classification E-value
Superfamily Subtilisin-like 1.44e-81
Family Subtilases 0.00000000865
Further Details:      
 
Domain Number 2 Region: 453-599
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.28e-42
Family Proprotein convertase P-domain 0.0000998
Further Details:      
 
Domain Number 3 Region: 30-101
Classification Level Classification E-value
Superfamily Protease propeptides/inhibitors 0.00000000000000134
Family Prohormone convertase 1 pro-domain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000011760   Gene: ENSNLEG00000009653   Transcript: ENSNLET00000012340
Sequence length 638
Comment pep:known_by_projection supercontig:Nleu1.0:GL397314.1:11040961:11303977:1 gene:ENSNLEG00000009653 transcript:ENSNLET00000012340 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKGGCVSQWKAAAGFLFCVMVFASAERPVFTNHFLVELHKGGEDAARQVAAEHGFGVRKL
PFAEGLYHFYHNGLAKAKRRRSLHHKQQLERDPRVKMALQQEGFDRKKRGYRDINEIDIN
MNDPLFTKQWYLINTGQADGTPGLDLNVAEAWELGYTGKGVTIGIMDDGIDYLHPDLASN
YNAEASYDFSSNDPYPYPRYTDDWFNSHGTRCAGEVSAAANNNICGVGVAYNSKVAGIRM
LDQPFMTDIIEASSISHMPQLIDIYSASWGPTDNGKTVDGPRELTLQAMADGVNKGRGGK
GSIYVWASGDGGSYDDCNCDGYASSMWTISINSAINDGRTALYDESCSSTLASTFSNGRK
RNPEAGVATTDLYGNCTLRHSGTSAAAPEAAGVFALALEANLGLTWRDMQHLTVLTSKRN
QLHDEVHQWRRNGVGLEFNHLFGYGVLDAGAMVKMAKDWRTVPERFHCVGGSAQDPEKIP
STGKLVLTLTTDACEGKENFVRYLEHVQAVITVNATRRGDLNINMTSPMGTKSILLSRRP
RDDDSKVGFDKWPFMTTHTWGEDARGTWTLELGFVGSAQQKGVLKEWTLMLHGTQSAPYI
DQVVRDYQSKLAMSKKEELEEELDEAVERSLKSILNKN
Download sequence
Identical sequences G1REW0
ENSNLEP00000011760 XP_003268251.1.23891 ENSNLEP00000011760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]