SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000011766 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000011766
Domain Number 1 Region: 20-99
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000167
Family I set domains 0.00061
Further Details:      
 
Domain Number 2 Region: 104-186
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000069
Family I set domains 0.00091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000011766   Gene: ENSNLEG00000009671   Transcript: ENSNLET00000012346
Sequence length 278
Comment pep:known_by_projection supercontig:Nleu1.0:GL397275.1:532335:541011:1 gene:ENSNLEG00000009671 transcript:ENSNLET00000012346 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWFLTVLLLWVPVDGQVDTTKAVITLQPPWVSVFQEETVTLQCEVFHPPGSSSTQWFLNG
TATQTSTPSYRITSASVNDSGEYRCQRGLSGKSDPIQLEIHRGWLLLQVSSRVFTEGEPL
ALRCHAWKDKLVYNVLYYRNGKAFKFFHWNSNLTILKTNISHNGTYHCSGMGKHRYTSAG
VSVTVKGLQLPTPVWFHVLFYLAVGIMFLVNTVLWVTICKELKRKKEWNLEISLDSGHEK
KVISSLQEDRHLEEVLKCQEEEEQLQEGVHRKEPQGAK
Download sequence
Identical sequences A0A2I3H7P4
ENSNLEP00000011766 XP_003259190.1.23891 ENSNLEP00000011766

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]