SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000011781 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000011781
Domain Number 1 Region: 160-266
Classification Level Classification E-value
Superfamily Cadherin-like 1.83e-30
Family Cadherin 0.00043
Further Details:      
 
Domain Number 2 Region: 261-381
Classification Level Classification E-value
Superfamily Cadherin-like 6.81e-28
Family Cadherin 0.0028
Further Details:      
 
Domain Number 3 Region: 370-473
Classification Level Classification E-value
Superfamily Cadherin-like 2.71e-19
Family Cadherin 0.0034
Further Details:      
 
Domain Number 4 Region: 41-160
Classification Level Classification E-value
Superfamily Cadherin-like 3.01e-17
Family Cadherin 0.0063
Further Details:      
 
Domain Number 5 Region: 2-50
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000576
Family Cadherin 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000011781   Gene: ENSNLEG00000009682   Transcript: ENSNLET00000012361
Sequence length 898
Comment pep:novel supercontig:Nleu1.0:GL397305.1:9329016:9340801:-1 gene:ENSNLEG00000009682 transcript:ENSNLET00000012361 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TVQGPVDREDLSTLRFSVLAKDRGTNPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQD
GMANISEDVAEETAVALVQVSDRDEGENAAVTCVVAGDVPFQLRQASETGSDSKKKYFLQ
TTTPLDYEKVKDYTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQTVTEVAFPENN
KPGEVIAEITASDADSGSNAELVYSLEPEPAAKGLFTISPETGEIQVKTSLDREQRESYE
LKVVAADRGSPSLQGTATVLVNVLDCNDNDPKFMLSGYNFSVMENMPALSPVGMVTVIDG
DKGENAQVQLSVEQDNGDFVIQNGTGTILSSLSFDREQQSTYTFQLKAVDGGVPPRSAYV
GVTINVLDENDNAPYITAPSNTSHRLLTPQTRLGETVSQVAAEDFDSGVNAELIYSIAGG
NPYGLFQIGSHSGAITLEKEIERRHHGLHRLVVKVSDRGKPPRYGTALVHLYVNETLANR
TLLETLLGHSLDTPLDIDIAGDPEYERSKQRGNILFGVVAGVVAVALLIALAVLVRYCRQ
REAKSGYQAGKKETKDLYAPKPSGKASKGNKSKGKKSKSPKPVKPVEDEDEAGLQKSLKF
NLMSDAPGDSPRIHLPLNYPPGSPDLGRHYRSNSPLPSIQLQPQSPSASKKHQVVQDLPP
ANTFVGTGDTTSTGSEQYSDYSYRTNPPKYPSKQLPHRRVTFSATSQAQELQDPSQHSYY
DSGLEESETPSSKSSSGPRLGPLALPEDHYERTTPDGSIGEMEHPENDLRPLPDVAMTGT
CTRECSEFGHSDTCWMPGQSSPSRRTKSSALKLSTFVPYQDRGGQEPAGAGSPSPPEDRN
TKTAPVRLLPSYSAFSHSSHDSCKDSATLEEIPLTQTSDFPPAATPASAQTAKREIYL
Download sequence
Identical sequences ENSNLEP00000011781 ENSNLEP00000011781

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]