SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000011799 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000011799
Domain Number 1 Region: 1-131
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.5e-37
Family Dual specificity phosphatase-like 0.0011
Further Details:      
 
Domain Number 2 Region: 173-240
Classification Level Classification E-value
Superfamily SMAD/FHA domain 0.00000082
Family Interferon regulatory factor 3 (IRF3), transactivation domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000011799   Gene: ENSNLEG00000009704   Transcript: ENSNLET00000012381
Sequence length 290
Comment pep:known_by_projection supercontig:Nleu1.0:GL397356.1:3519303:3540785:-1 gene:ENSNLEG00000009704 transcript:ENSNLET00000012381 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLPGLYLGNFIDAKDLDQLGRNKITHIISIHESPQPLLQDITYLRIPVADTPEVPIKKHF
KECINFIHCCRLNGGNCLVHCFAGISRSTTIVTAYVMTVTGLGWRDVLEAIKATRPIANP
NPGFRQQLEEFGWGSSRKGARHRTPKTPGAQCPPMTSATCLLAARVALLGAALVREATGC
TAQRCRLSPRAAAERLLGPPPHVAAGWSPDPKYQICLCFGEEDPGPTEHPEEQLIMAHVQ
VQLWPGSSSCTLSASTECPDGSSTPGNPNGITHLQHSCLHPKPATSSPCT
Download sequence
Identical sequences ENSNLEP00000011799 ENSNLEP00000011799

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]