SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000011801 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000011801
Domain Number 1 Region: 1-131
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 7.89e-38
Family Dual specificity phosphatase-like 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000011801   Gene: ENSNLEG00000009704   Transcript: ENSNLET00000012383
Sequence length 228
Comment pep:known_by_projection supercontig:Nleu1.0:GL397356.1:3531881:3540785:-1 gene:ENSNLEG00000009704 transcript:ENSNLET00000012383 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLPGLYLGNFIDAKDLDQLGRNKITHIISIHESPQPLLQDITYLRIPVADTPEVPIKKHF
KECINFIHCCRLNGGNCLVHCFAGISRSTTIVTAYVMTVTGLGWRDVLEAIKATRPIANP
NPGFRQQLEEFGWGSSRKLRRQLEERFGESPFRDEEELRALLPLCKRCRQGSATSASSAG
PHSAASEGTLQRLVPRTPREAHRPLPLLARVKQTFSCLPRCLSRKGGK
Download sequence
Identical sequences G1RF01
ENSNLEP00000011801

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]