SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000011807 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000011807
Domain Number 1 Region: 232-356
Classification Level Classification E-value
Superfamily Cadherin-like 3.85e-28
Family Cadherin 0.00068
Further Details:      
 
Domain Number 2 Region: 448-569
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-26
Family Cadherin 0.0017
Further Details:      
 
Domain Number 3 Region: 129-236
Classification Level Classification E-value
Superfamily Cadherin-like 2.71e-20
Family Cadherin 0.0066
Further Details:      
 
Domain Number 4 Region: 345-452
Classification Level Classification E-value
Superfamily Cadherin-like 1.86e-18
Family Cadherin 0.0034
Further Details:      
 
Domain Number 5 Region: 615-694
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000857
Family Cadherin 0.0099
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000011807
Domain Number - Region: 30-127
Classification Level Classification E-value
Superfamily Cadherin-like 0.00642
Family Cadherin 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000011807   Gene: ENSNLEG00000009706   Transcript: ENSNLET00000012389
Sequence length 1185
Comment pep:known_by_projection supercontig:Nleu1.0:GL397305.1:9419489:9432397:-1 gene:ENSNLEG00000009706 transcript:ENSNLET00000012389 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMQLLQLLLGLLGPGGYLFLLGDCQEVTTLTVKYQVSEEVPSGTVIGKLSQELGRDERRR
QAGAAFQVLQLPQALPIQVDSEEGLLSTGRRLDREQLCRHWDPCLVSFDVLATGDLALIH
VEIQVLDINDHQPRFPKGEQELEISESASLRTRIPLDRALDPDTGPNTLHTYTLSPSEHF
ALDVIVGPDETKHAELVVVKELDREIHSFFDLVLTAYDNGNPPKSGTSLVKVNVLDSNDN
SPVFAESSLALEIQEDAAPGTPLIKLTATDPDQGPNGEVEFFLSKHMPPEVLDTFSIDAK
TGQVILRRPLDYEKNPAYEVDVQARDLGPNPIPAHCKVLIKVLDVNDNIPSIHVTWASQP
SLVSEALPKDSFIALVMADDLDSGNNGLVHCWLSQELGHFRLKRSNGNTYMLLTNATLDR
EQWPKYTLTLLAQDQGLQPLSAKKQLSIQISDINDNAPVFEKSRYEVSTRENNLPSLHLI
TIKAHDADLGINGKVSYRIQDSPVAHLVAIDSNTGEVTAQRSLNYEEMAGFEFQVIAEDS
GQPVLASSVSVYVSLLDANDNAPEVVQPVLSDGKASLSVLVNASTGHLLVPIETPSGLGP
AGTDTPPLATHSSRPFLLTTIVARDADSGANGEPLYSIRSGNEAHLFILNPHAGQLFINV
TNASSLIGSEWELEIVVEDQGSPPLQTQALLRVMFVTSVDHLRDSARKPGALSMSMLTAI
CLAVLLGIFGLILALFMSICRTEKKDNRAYNCREAESTYRQQPKRPQKHIQKADIHLVPV
LRGQAGEPCEVGQSHKDVDKEAMMEAGWDPCLQAPFHLTPTLYRTLRNQGNQGAPAESRE
VLQDTVNLLFNHPRQRNASRENLNLPEPQPATGQSCSRPLKVASSPTGRLARDQGSEEAP
QSPPTSSATLRRQRHLNGKVSPEKESGPRQILRSLVRLSVAAFAERNPVEELTVDSPPVQ
QISQLLSLLHQGQFQPRPNHRGNKYLAKPGGSRSAIPDTDGPSARAGGQTDPEQEEGSLD
PEEDLSVKQLLEEELSSLLDPSTGLALDRLSAPDPAWMARLSLPLTTNYRDNVISPDAAA
TEEPRTFQTFGKAEAPELSPTGTRLASTFVSEMSSLLEMLLEQRSSMPVEAASEALRRLS
VCGRTLSLDLATSAASGMKVQGDPGGKTGTDGRSRGSSSSSSRCL
Download sequence
Identical sequences G1RF07
ENSNLEP00000011807 XP_012360343.1.23891 ENSNLEP00000011807

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]