SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000011897 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000011897
Domain Number 1 Region: 2405-2666
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.47e-31
Family Extended AAA-ATPase domain 0.055
Further Details:      
 
Domain Number 2 Region: 1780-1990
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.31e-26
Family Extended AAA-ATPase domain 0.021
Further Details:      
 
Domain Number 3 Region: 2725-2846,2878-3003
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.81e-16
Family Extended AAA-ATPase domain 0.049
Further Details:      
 
Domain Number 4 Region: 2010-2227
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000981
Family ABC transporter ATPase domain-like 0.064
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000011897
Domain Number - Region: 1062-1139
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0101
Family Spectrin repeat 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000011897   Gene: ENSNLEG00000009763   Transcript: ENSNLET00000012479
Sequence length 4189
Comment pep:known_by_projection supercontig:Nleu1.0:GL397365.1:2748906:2863782:1 gene:ENSNLEG00000009763 transcript:ENSNLET00000012479 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSKAEKKQRLSGRGSSRASRSAGAPQAAVATWEQGNALAVSEPEPQAELPKEEPEPRLE
GPQAQSEGSVEPEADVKPLFLSRAALTGLADAVWTQEHDAILEHFAQDPTESILTIFIDP
CFGLKLELGMPVQTQNQLVYFIRQAPVPITWENFEATVQFGTVRGPYIPALLRLLSGVFA
PQIFANTGWPESIRNHFASHLHKFLACLTDTRYKLEGHTVLYIPAEAMNMKPEVAVKDKE
LVQRLETSMIHWTRQIKEMLSAQETVETGENLGPLEEIEFWRNRCMDLSGISKQLVKKGV
KHVESILHLAKSSYLAPFMKLAQQIQDGSRQAQSNLTFLSILKEPYQELAFMKPKDISSK
LPKLISLIRIIWVNSPHYNTRERLTSLFRKVCDCQYHFARWEDGKQGPLPCFFGAQGPQI
TRNLLEIEDIFHKNLHMLRAVRGGILDVKNTSWHEDYNKRGQGRQIRQPRVEEWRECAKE
IVEGQIGIGAMGTFRRPSCLHAIKRTYDKKAVDLYMLFNSELALVNRERNKKWPDLEPYM
AQYSGQARWVHILRRRIDRVMTCLAGAHFLPHIGTGEESVHTYQQMVQAIDELVRKTFQE
WTSTLDKDCIRRLDTPLLRISQEKAGMLDVNFDKSLLILFVEIDYWERLLFETPHYVVNV
AERAEDLRILRENLLLVARDYNRIIGMLSPDEQALFKERIRFLDKKIHPGLKKLHWALKG
ASAFFITECRIHASKVQMIVNEFKASTLTIGWRAQEMSETLLVRISGKRVYRDLEFEEDQ
REHRAAVQQKLMNLHQDVVTIMINSYEVFKNDGPEIQQQWMLYMIRLDRMVEDALRLNVK
WSLLELSKAINGDGKTSPNPLFQVFVILKNDMQGSVAQVEFSPTLQTLAAVVNDIGNHLF
STISVFRHLPDILTKRKLHREPIQTVVEQDEDIKKIQTQISSGMTNNASLLQNYLKTWDM
YREIWEINKDSFIRRYQRLNPPVSSFDADIARLSVRGTALQEEPGPRVLGKIREDLDRTY
FSLVQHCNEWQNKFTTLLREMAAGRLLELHTYLKENAEKISRPPQTLEELGVSLQLMDAL
QHDLANVETQIPPVHEQFAILEKYEVPVEDSVREMLDSLNGEWVVFQQTLLDSEQMLKKH
KEKFKTGLIHSADEFKKKAHTLLEDFEFKGPFTSNVGYMSALDQITQVRAMLMAMREEEN
SLRANLGIFKMEQPPSKDLQNLEKELDALQQIWEITRDWEENWNEWKTGRFLTLQTETME
TMAHGLFRRLTRLAKEYKDRNWEIIKTTRSKIEQFKRTMPLISDLRNPALRERHWDQVRD
EIQREFDQESESFTLEQIVELGMDQHVEKIGEISASAAKELAIEVSLQNIAKTWDVIQLD
IVPYKDKGHHRLRGTEEVFQALEDNQVALSTMKASRFVKAFEKDVDHWERCLSLILEVIE
MILTVQRQWMYLENIFLGEDIRKQLPNESTLFDQVNSNWKAIMDRMNKDNNALRSTHHPG
LLDTLIEMNTILEDIQKSLDMYLETKRHIFPRFYFLSNDDLLEILGQSRNPEAVQPHLKK
CFDNIKLLRIQKVGGPSSKWEAVGMFSGDGEYIDFPHSVFLEGPIESWLGDVERTMRVTL
RDLLRNCRLALKKFLNKRDKWVKEWAGQVVITASQIQWTADVTKCLLTAKERADKKILKV
MKKKQVSILNKYSEAIRGNLTKIMRLKIVALVTIEIHARDVLEKLYKSGLMDVNSFDWLS
QLRFYWEKDLDDCMIRQTNTQFQYSYEYLGNSGRLVITPLTDRCYMTLTTALHLHRGGSP
KGPAGTGKTETVKDLGKALGVYVIVVNCSEGLDYKSMGRMYSGLAQTGAWGCFDEFNRIN
IEVLSVVAQQILSILSALAAGLTRFHFDGFEINLVWSCGIFITMNPGYAGRTELPENLKS
MFRPIAMVVPDSTLIAEIILFGEGFGNCKILAKKVYTLYSLAVQQLSRQDHYDFGLRALT
SLLRYAGKKRRLQPDLTDEEVLLLSMRDMNIAKLTSVDAPLFNAIVQDLFPNTELPVIDY
GKLRETVEQEIRDMDLQSTPFTLTKVFQLYETKNSRHSTMIVGCTGSGKTASWRILQASL
SSLCRAGDPNFNIVREFPLNPKALSLGELYGEYDLSTNEWDGILSSVMRTACADEKPDEK
WILFDGPVDTLWIESMNSVMDDNKVLTLINGERIAMPEQVSLLFEVENLAVASPATVSRC
GMVYTDYADLGWKPYVQSWLKKRPKAEVEPLQRMFEKLINKMLAFKKDNCKELVPLPEYS
GITSLCKLYSALATPENGVNPADGENYVTMVEMTFVFSMIWSVCASVDEEGRKRIDSYLR
EIEGSFPNKDTVYEYFVDPKIRSWTSFEDKLPKSWRYPPNSPFYKIMVPTVDTVRYNYLV
STLVANQNPVLLVGPVGTGKTSIAQSVLQSLPSSQWSVLIVNMSAQTTSNNVQSIIESRV
EKRTKGVYVPFGGKSMITFMDDLNMPAKDMFGSQPPLELIRLWIDYGFWYDRAKQTIKYI
REMFLMAAMGPPGGGRTVISPRLQSRFNIINMTFPTESQIIRIFGTMINQKLQDFEEEVK
PIGNVVTEATLDVYNTVVQRFLPTPTKIHYLFNLRDISKVFQGMLRANKDFHDTKSSITR
LWIHECFRVFSDRLVDAADTEAFMGIISDKLGSFFDLTFHHLCPSKRPPIFGDFLKEPKV
YEDLTDLTVLKTVMETALNEYNLSPSVVPMQLVLFREAIEHITRIVRVIGQPRGNMLLVG
IGGSGRQSLARLASSICDYTTFQIEVTKHYRKQEFRDDIKRLYRQAGVELKTTSFLFVDT
QIADESFLEDINNILSSGEVPNLYKPDEFEEIQSHIIDQARAEQVPESSDSLFTYLIERV
RNNLHIVLCLSPVGDPFSPFCVLPHPAVASCAFWKSVREPPRPATICLSLICVLFVEMGF
RHIHRKVAQIFVTMHWSVAQYSQKMLLELRRHNYVTPTNYLELVSGYKKYEAGQGILHLK
KKKKFFSFLFHLFHQHLEEIKCQALADNAQKDLEEALPALEEAMRSSLSSKTLGKWEEEA
LESLNKKDIGEIKSYGRPPAQVEIVMQAVMILRGNEPTWAEAKRQLGEQNFIKSLINFDK
DNISDKVLKKIGYCAQDFQDIIGRVSLAAKSLCMWVRAMELYGRLYRVVEPKRIRMNAAL
AQLREKQAALAEAQEKLREVAEKLEMLKKQYDEKLAQKEELHKKSEEMELKLERAGMLVS
GLAGEKARWEETVQQWKERLFASLGICFKNRHGTSCFCPSVSSWLRKKIVNQIWIRKIWE
LQVPCSPSFAIDNFLSNPTKVRDWNIQGLPSDAFSTENGIIVTRGNRWALMIDPQAQALK
WIKNMEGGQGLKIIDLQMSDYLRILENAIQFGYPVLLQNVQEYLDPTLNPVLNKSVARIV
VAVMHIGDKEEYNNNFRFYITTKLSNPHYSPETSAKTTIVNFAVKEQGLEAQLLGIVVRK
ERPELEEQKDSLVINIAAGKRKLKELEDEILRLLNEATGSLLDDVQLVNTLQTSKITATE
VTEQLETSETTEINIDLAREAYRPCAQRASILFFVLNDMGCIDPMYQFSLDAYISLFILS
IDKSHRSNKLEDRIDYLNDYHTYAVYRYTCRTLFERHKLLFSFHMCAKILETSGKLNMDE
YNFFLRGGVVLDREGQMDNPCTSWLADAYWDNITELDKLTNFHGLMNSFEQYPRDWHLWY
TSAAPEKAMLPGEWENACNEMQRMLIVRSLRQDRVAFCVTSFIVTNLGSRFIEPPVLNMK
LVMEDSTPRSPLVFILSPGVDPTSALLQLAEHMGMAQRFHALSLGQGQAPIAARLLREGV
TQGCTIIAHSFHTFLSQPPRLRIFINYMQVIKDHDSMNIYGVSLCHPGWSLSMMHVTPSL
YHCPQGLKANMTRLYQLMSEPQFSRCSKPAKYKKLLFSLCFFHSVLLERKKFLQLGWNII
YGFNDSDFEVSENLLSLYLDEYEETPWDALKYLIAGINYGGHVTDDWDRRLLTTYINDYF
CDQSLSTPFYRLSALETYFIPKDGSLGSYKEYISLLPGMDPPEAFGQHPNADVASQIAEA
RTLFDTLLSLQPQITPTRAGGQTREEKVLELAADVKQKIPEMIDYEGTRKLLALDPSPLN
VVLLQEIQRYNTLMQTILQSPCSLSIPSCVSHKSGRVVLELSSVKHPRQ
Download sequence
Identical sequences ENSNLEP00000011897 ENSNLEP00000011897

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]