SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000011899 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000011899
Domain Number 1 Region: 582-673
Classification Level Classification E-value
Superfamily Immunoglobulin 5.98e-22
Family I set domains 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000011899   Gene: ENSNLEG00000009754   Transcript: ENSNLET00000012481
Sequence length 675
Comment pep:known_by_projection supercontig:Nleu1.0:GL397278.1:10882827:10933254:1 gene:ENSNLEG00000009754 transcript:ENSNLET00000012481 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNDISQKAEILLSSSKPVPKTYVPKLGKGDVKDKFEAMQRAREERNQRRSRDEKQRRKEQ
YIREREWNRRKQEIKEMLASDDEEDVSSKVEKAYVPKLTGTVKGRFAEMEKQRQEEQRKR
TEEERKRRIEQDMLEKRKIQRELAKRAEQIEDINNTGTESTSEEGDDSLLITVVPVKSYK
TSGKMKKNFEDLEKECEEKERIKYEEDKRIRYEEQRRSLKEAKCLSLVMDDEIEGEAKKE
SLSPGKLKLTFEELERQRQENRKKQAEEEARKRLEEEKRAFEEARRQMVNEEEENQDTAK
IFKGYRPGKLKLSFEEMERQRREDEKRKAEEEARRRIEEEKKAFAEARRNMVVDDDSPEM
YKTISQESLTPGKLEINFEELLKQKMEEEKRRTEEERRHKLEMEKQEFEQLRQEMGEEEE
ENETFGLSREYEELIKLKRSGSIQAKNLKSKFEKIGQLSEKEIQKKIEEERARRRAIDLE
IKEREAENFHEEDDVDVRPARKSEAPFTHKVNMKARFEQMAKAREEEEQRRIEEQKLLRM
QFEQREIDAALQKKREEEEEEEGSIMNGSTTEDEEQTRSGAPWFKKPLKNTSVVDSEPVR
FTVKVTGEPKPEITWWFEGEILQDGEDYQYIERGETYCLYLPETFPEDGGEYMCKAVNSK
GSAASTCILTIESKN
Download sequence
Identical sequences G1RF99
XP_003260278.1.23891 ENSNLEP00000011899 ENSNLEP00000011899

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]