SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000012029 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000012029
Domain Number 1 Region: 301-599
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.29e-86
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.000000189
Further Details:      
 
Domain Number 2 Region: 122-300
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 6.02e-44
Family Threonyl-tRNA synthetase (ThrRS), second 'additional' domain 0.00064
Further Details:      
 
Domain Number 3 Region: 601-709
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 3.78e-25
Family Anticodon-binding domain of Class II aaRS 0.001
Further Details:      
 
Domain Number 4 Region: 62-122
Classification Level Classification E-value
Superfamily TGS-like 0.00000000012
Family TGS domain 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000012029   Gene: ENSNLEG00000009858   Transcript: ENSNLET00000012614
Sequence length 718
Comment pep:known_by_projection supercontig:Nleu1.0:GL397275.1:1187666:1207716:1 gene:ENSNLEG00000009858 transcript:ENSNLET00000012614 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALYQRWRRLRLQGLQACRLHTAVVSTPPRWLAERLGLFEELWAAQVKRLASMAQKEPRT
IKISLPGDQKIDAVAWNTTPYQLARQISSTLADTAVAAQVNGEPYDLERPLETDSDLRFL
TFDSPEGKAVFWHSSTHVLGAAAEQFLGAVLCRGPSTEYGFYHDFFLGKERTIRGSELPV
LERICQELTAAAQPFRRLEASRDQLRQLFKDNPFKLHLIEERVTGPTATVYGCGTLVDLC
QGPHLRHTGQIGGLKLLSNSSSLWRSSGAPETLQRVSGISFPTTELLRAWEAWREEAELR
DHRRIGKEQELFFFHELSPGSCFFLPRGTRVYNALVAFIRAEYARRGFSEVKTPTLFSTK
LWEQSGHWEHYQEDMFAVQPPGSDRPPSSQSDDSTRHITDTLALKPMNCPAHCLMFAHRP
RSWRELPLRLADFGALHRAEASGSLRGLTRLRCFQQDDAHIFCTTDQLEAEIQSCLDFLR
SVYAVLGFSFRLALSTRPSGFLGDPCLWDQAEQVLKQALKEFGEPWDLNSGDGAFYGPKI
DVHLHDALGRPHQCGTIQLDFQLPLRFDLQYKGQAGALERPVLIHRAVLGSMERLLGVLA
ESCGGKWPLWLSPFQVVVIPVGTEQEEYAREAQQSLQAAGLVSDLDADSGLTLSRRIRQA
QLAHYNFQFVVGQKEQSKRTVNIRTRDNRRLGEWDLPEAVQRLVELQNTRVPNAEEIF
Download sequence
Identical sequences G1RFM9
ENSNLEP00000012029 ENSNLEP00000012029 XP_003259222.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]