SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000012048 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000012048
Domain Number 1 Region: 597-676
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00000000000102
Family Canonical RBD 0.014
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000012048
Domain Number - Region: 276-302
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000196
Family CCCH zinc finger 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000012048   Gene: ENSNLEG00000009886   Transcript: ENSNLET00000012636
Sequence length 1060
Comment pep:novel supercontig:Nleu1.0:GL397305.1:13829518:13925041:1 gene:ENSNLEG00000009886 transcript:ENSNLET00000012636 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLIEDVDALKSWLAKLLEPICDADPSALANYVVALVKKDKPEKELKAFCADQLDVFLQKE
TSGFVDKLFESLYTKNYLPPLEPVKPEPKPLVQEKEEIKEEVFQEPAEEERDGRKKKYPS
PQKTRSESSERRTREKKREDGKWRDYDRYYERNELYREKYDWRRGRSKSRSKSRGLSRSR
SRSRGRSKDRDPNRNVEHRERSKFKSERNDLESSYVPVSAPPPNSSEQYSSGAQSIPSTV
TVIAPAHHSENTTESWSNYYNNHSSSNSFGRNLPPKRRCRDYDERGFCVLGDLCQFDHGN
DPLVVDEVALPSMIPFPPPPPGLPPPPPPGMLMPPMPGPGPGPGPGPGPGPGPGPGPGHS
MRLPVPQGHGQPPPSVVLPIPRPPITQSSLINSRDQPGTSAVPNLASVGTRLPPPLPQNL
LYTVSERQPMYSREHGAAASERLQLGTPPPLLAARLVPPRNLMGSSIGYHTSVSSPTPLV
PDTYEPDGYNPEAPSITSSGRSQYRQFFSRTQTQRPNLIGLTSGDMDANPRAANIVIQTE
PPVPVSINSNITRVVLEPDSRKRAMSGLEGPLTKKPWLGKQGSNNQNKPGFLRKNQYTNT
KLEVKKIPQELNNITKLNEHFSKFGTIVNIQVAFKGDPEAALIQYLTNEEARKAISSTEA
VLNNRFIRVLWHRENNEQPTLQSSAQLLLQQQQTLSHLSQQHHHLPQHLHQQQVLVAQSA
PSTVHGGIQKMMNKPQTSGAYVLNKVPVKHRLGHAGGNQTDASHLLNQSGSAGEDCQIFS
TPGHPKMIYSSSNLKTPSKLSSGSKSHDVQEVLKKKQEAMKLQQDMRKKRQEVLEKQIEC
QKMLISKLEKNKNMKPEERANIMKTLKELGEKISQLKDELKTSSAVSTPSKVKTKTEAQK
ELLDTELDLHKRLSSGEDTTELRKKLSQLQVEAARLGILPVGRGKTMSSQGRGRGRGRGG
RGRGSLNHMVVDHRPKALTVGGFIEEEKEDLLQHFSAANQGPKFKDRRLQISWHKPKVPS
ISTETEEEEVKEEETETSDLFLPDDDDEDEDEYESRSWRR
Download sequence
Identical sequences A0A2I3H5Q6
ENSNLEP00000012048 XP_003266630.1.23891 ENSNLEP00000012048

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]