SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000012053 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000012053
Domain Number 1 Region: 158-248,284-529
Classification Level Classification E-value
Superfamily MFS general substrate transporter 1.26e-28
Family Glycerol-3-phosphate transporter 0.098
Further Details:      
 
Domain Number 2 Region: 547-591
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000018
Family Ovomucoid domain III-like 0.015
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000012053
Domain Number - Region: 664-743
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.0497
Family Glycerol-3-phosphate transporter 0.091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000012053   Gene: ENSNLEG00000009897   Transcript: ENSNLET00000012641
Sequence length 778
Comment pep:known_by_projection supercontig:Nleu1.0:GL397482.1:16051:61942:1 gene:ENSNLEG00000009897 transcript:ENSNLET00000012641 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKRRVAAGEARAWSAALRGGRALETGTDTPAPWIPLGHSHCVAEALRSPGGGAEMPLHQL
GDKPLTFPSPNSAMENGLDHTLPSRRASPGTPLSPGSLCSAAHSPLDTSKQPLWQLWAEK
RGARGTHEVRHVSAGQSVACGWWAFAPPCLQVLNTPKGVLFFLCAAAFLQGMTVNGFINT
VITSLERRYDLHSYQSGLIASSYDIAACLCLTFVSYFGGSGHKPRWLGWGVLLMGTGSLV
FALPHFTAGRYEVEVDAGVGTCPANPSAACGDSTSGLSRYQLVFMLGQFLHGVGATPLYT
LGVTYLDENVKSSYSPVYIAIFYTAAILGPAAGYLIGGALLNIYTEMGRRTELTTESPLW
VGAWWVGFLGSGAAAFFTAVPILGYPRQLPGSQRYAVIRAAEMHQLKDGSRGEASNPDFG
KTIRDLPLSIWLLLKNPTFILLCLAGATEATLITGMSTFSPKFLESQFSLSASEAATLFG
YLVVPAGGGGTFLGGFFVNKLRLRGSAVIKFCLFCTVVSLLGILVFSLHCPSVPMAGADG
AGGHGLLPEGHLNLTASCNAACGCQPERYSPVCGSDGLVYFSLCHAGCPAATETNVDGQK
VSGAAAAPSNVVEFSGFGHATAGKCTSTCQRKPLLLHSCTNGNSTTGALQETPRSKQACL
CVRDPQRSFALGIQWIVVRILGGIPGPIAFGWVIDKACLLWQDQCGQQGSCLVYQNSAMS
SYILIMGLLYKVLGILFFAVACFLYKPLLESSDGLEACLPSQSSAPDSATESQLQSSV
Download sequence
Identical sequences ENSNLEP00000012053

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]