SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000012056 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000012056
Domain Number 1 Region: 159-248,284-537,636-737
Classification Level Classification E-value
Superfamily MFS general substrate transporter 7.32e-31
Family Glycerol-3-phosphate transporter 0.098
Further Details:      
 
Domain Number 2 Region: 547-591
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000208
Family Ovomucoid domain III-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000012056   Gene: ENSNLEG00000009897   Transcript: ENSNLET00000012644
Sequence length 776
Comment pep:known_by_projection supercontig:Nleu1.0:GL397482.1:16051:61942:1 gene:ENSNLEG00000009897 transcript:ENSNLET00000012644 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKRRVAAGEARAWSAALRGGRALETGTDTPAPWIPLGHSHCVAEALRSPGGGAEMPLHQL
GDKPLTFPSPNSAMENGLDHTLPSRRASPGTPLSPGSLCSAAHSPLDTSKQPLWQLWAEK
RGARGTHEVRHVSAGQSVACGWWAFAPPCLQVLNTPKGVLFFLCAAAFLQGMTVNGFINT
VITSLERRYDLHSYQSGLIASSYDIAACLCLTFVSYFGGSGHKPRWLGWGVLLMGTGSLV
FALPHFTAGRYEVEVDAGVGTCPANPSAACGDSTSGLSRYQLVFMLGQFLHGVGATPLYT
LGVTYLDENVKSSYSPVYIAIFYTAAILGPAAGYLIGGALLNIYTEMGRRTELTTESPLW
VGAWWVGFLGSGAAAFFTAVPILGYPRQLPGSQRYAVIRAAEMHQLKDGSRGEASNPDFG
KTIRDLPLSIWLLLKNPTFILLCLAGATEATLITGMSTFSPKFLESQFSLSASEAATLFG
YLVVPAGGGGTFLGGFFVNKLRLRGSAVIKFCLFCTVVSLLGILVFSLHCPSVPMAGVTS
SXXXXLLPEGHLNLTASCNAACGCQPERYSPVCGSDGLVYFSLCHAGCPAATETNVDGQK
VSGAAAYRPVVEFSGFGHATAGKCTSTCQRKPLLLVFIFVVIFFTFLSSIPALTATLRCV
RDPQRSFALGIQWIVVRILGGIPGPIAFGWVIDKACLLWQDQCGQQGSCLVYQNSAMSSY
ILIMGLLYKVLGILFFAVACFLYKPLLESSDGLEACLPSQSSAPDSATESQLQSSV
Download sequence
Identical sequences ENSNLEP00000012056

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]