SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000012084 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000012084
Domain Number 1 Region: 665-780,945-998
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00000000136
Family FAD/NAD-linked reductases, N-terminal and central domains 0.049
Further Details:      
 
Domain Number 2 Region: 463-569
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.0000465
Family N-acetyl transferase, NAT 0.018
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000012084
Domain Number - Region: 182-248
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.00093
Family N-myristoyl transferase, NMT 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000012084   Gene: ENSNLEG00000009893   Transcript: ENSNLET00000012675
Sequence length 1237
Comment pep:known_by_projection supercontig:Nleu1.0:GL397314.1:13927713:14243643:1 gene:ENSNLEG00000009893 transcript:ENSNLET00000012675 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVLTSPRGKVEVVHCRRTESQDIYCIKSLIRKFTCKLFGKLNIIYLLEKANLAVTLCND
KEEIMAQATFLDYPNWNVAKQDDWVSVFRELDSDIPCTPLNTLFMHLFVAVDEYSVGCCK
EILRTVYKAVPELHFIFLIVPSYMSLGSTLITVFDQVGNIPCLTYEEDFAVHICHRHSHY
PQLHVRKARVEDHDALMPIFMRYDTILKETYGEYFLAELIEAQDEENHAVACEVEGTAVG
FMSVCSRVNMQLLHECFDLGPFHGLCFPHPDDVLESPQELSVRRSQDAELRSSSRASQKI
VEESQEPVSPDTMENIQGNIAREAASEEALTAVQSGNVSEPEDIEKLSDVSTGYAQDHHV
SSRSLASLLLPEEPVHFRPIYRGASAAFCIQLFCIDEKYEARSLDFMNFVFSLFSDKNFC
VISLPHLTPEFILIQNFVKMVPFNTCTLEQDLYVFHRAGLLKSINIRFATLLDTPGVENL
VSTLMLNKSILEDLDRYNKARKDPDGTPLQAFVAEVAEQIVGIAVIRNEMDIEYIRSHYN
IEDFIYFSHHQREEHGHIHHFALNPIFRHYTKFFLKEILRLGFKSCLYYPVYPKSGEGKF
QNPYAHSLTSALHYLVPVRPRRQIVYPLEKLGINAPSKAVSKDPMSYALNHTNRKLTLEP
KITVNAKIIVVGASNVGISFLETLVFCSHLKFNNLTLISTHGLPGKKLLDTEQRKFLASD
HCFNDKDYALMSLCSWVNVVVGRMTGIDRAAKHVVLSTDEIVLYDHLILCTGQQYQVPCP
TEADISQHLTNREVPNSSQRRYTGKVPCNHFTLNEEEDCFKALTWIRNNSITTEGNVIVY
GNTIDTYTTVETLLNLGVSGSRIHLVQPPPASTITCINNYSVESAVADALGAAGVTMYRD
AILAQWNDGLHPDPIYSASFTTPTKPFRLQCSMFFSFCEKNVDYETFKALNDACLVYDGR
LVIDTNFHTNDIAVRAAGSLTKFSNRYYSNEWTHSNFSSKEIGFQLAAAMLHLFDPTLEP
VTEPPADLDRLIPMYKGAKIQGGILPGSYHYLHIAKPAIPTPLEVQMAQPNYGLEIVTGS
AKNGTYFRIHINKYKMVETITCLSREPFPASNYIRLFGQHEQLLNNLCARYDENLITDLY
SYFTEPWCLALFHDRFIDLRKELRQILASKEEEDLPSIEQLAHQIEDEEINPTEKPRQYL
KRVFEESVYKTLVERSTLDYLRYNHYHLPMYAWPGII
Download sequence
Identical sequences G1RFT4
ENSNLEP00000012084 ENSNLEP00000012084 XP_003268284.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]