SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000012100 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000012100
Domain Number 1 Region: 773-836
Classification Level Classification E-value
Superfamily FF domain 1.57e-16
Family FF domain 0.0000214
Further Details:      
 
Domain Number 2 Region: 643-708
Classification Level Classification E-value
Superfamily FF domain 9.29e-16
Family FF domain 0.0000173
Further Details:      
 
Domain Number 3 Region: 706-768
Classification Level Classification E-value
Superfamily FF domain 0.00000000000000445
Family FF domain 0.0033
Further Details:      
 
Domain Number 4 Region: 878-949
Classification Level Classification E-value
Superfamily FF domain 0.0000000000000114
Family FF domain 0.0000104
Further Details:      
 
Domain Number 5 Region: 944-1001
Classification Level Classification E-value
Superfamily FF domain 0.0000000000406
Family FF domain 0.0043
Further Details:      
 
Domain Number 6 Region: 407-439
Classification Level Classification E-value
Superfamily WW domain 0.00000000046
Family WW domain 0.00032
Further Details:      
 
Domain Number 7 Region: 136-168
Classification Level Classification E-value
Superfamily WW domain 0.000000000668
Family WW domain 0.0011
Further Details:      
 
Domain Number 8 Region: 496-534
Classification Level Classification E-value
Superfamily WW domain 0.0000000702
Family WW domain 0.0036
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000012100
Domain Number - Region: 1005-1070
Classification Level Classification E-value
Superfamily FF domain 0.00877
Family FF domain 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000012100   Gene: ENSNLEG00000009901   Transcript: ENSNLET00000012693
Sequence length 1088
Comment pep:known_by_projection supercontig:Nleu1.0:GL397305.1:14101782:14166800:1 gene:ENSNLEG00000009901 transcript:ENSNLET00000012693 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAERGGDGGDGERFNPGELRMAQQQALRFRGPAPPPNAVMRGPPPLMRPPPPFGMMRGPP
PPPRPPFGRPPFDPNMPPMPPPGGIPPPMGPPHLQRPPFMPPPMSSMPPPPGMMFPPGMP
PVTAPGTPALPPTEEIWVENKTPDGKVYYYNARTRESAWTKPDGVKVIQQSELTPMLAAQ
AQVQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQVQAQ
VQAQVQAQAVGASTPTTSSPAPAVSTSTSSSTPSSTTSTTTTATSVAQTVSTPTTQDQTP
SSAVSVATPTVSVSTPAPTATPVQTVPQPHPQTLPPAVPHSVPQPTTAIPAFPPVMVPPF
RVPLPGMPIPLPGVLPGMAPPIVPMIHPQVAIAASPATLAGATAVSEWTEYKTADGKTYY
YNNRTLESTWEKPQELKEKEKLEEKIKEPIKEPSEEPLPMETEEEDPKEEPIKEIKEEPK
EEEMTEEEKAAQKAKPVATAPIPGTPWCVVWTGDERVFFYNPTTRLSMWDRPDDLIGRAD
VDKIIQEPPHKKGMEELKKLRHPTPTMLSIQKWQFSMSAIKEEQELMEEINEDEPVKAKK
RKRMSKKSFMWIARASLFRRDDNKDIDSEKEAAMEAEIKAARERAIVPLEARMKQFKDML
LERGVSAFSTWEKELHKIVFDPRYLLLNPKERKQVFDQYVKTRAEEERREKKNKIMQAKE
DFKKMMEEAKFNPRATFSEFAAKHAKDSRFKAIEKMKDREALFNEFVAAARKKEKEDSKT
RGEKIKSDFFELLSNHHLDSQSRWSKVKDKVESDPRYKAVDSSSMREDLFKQYIEKIAKN
LDSEKEKELERQARIEASLREREREVQKARSEQTKEIDREREQHKREEAIQNFKALLSDM
VRSSDVSWSDTRRTLRKDHRWESGSLLEREEKEKLFNEHIEALTKKKREHFRQLLDETSA
ITLTSTWKEVKKIIKEDPRCIKFSSSDRKKQREFEEYIRDKYITAKADFRTLLKETKFIT
YRSKKLIQESDQHLKDVEKILQNDKRYLVLDCVPEERRKLIVAYVDDLDRRGPPPPPTAS
EPTRRSTK
Download sequence
Identical sequences ENSNLEP00000012100 XP_010376512.1.97406 XP_012360526.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]