SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000012172 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000012172
Domain Number 1 Region: 1619-1718
Classification Level Classification E-value
Superfamily Plakin repeat 1.15e-18
Family Plakin repeat 0.0054
Further Details:      
 
Domain Number 2 Region: 232-357,545-571
Classification Level Classification E-value
Superfamily Spectrin repeat 6.9e-16
Family Spectrin repeat 0.0095
Further Details:      
 
Domain Number 3 Region: 655-766
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000532
Family Spectrin repeat 0.0091
Further Details:      
 
Domain Number 4 Region: 105-176
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000432
Family Spectrin repeat 0.0088
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000012172
Domain Number - Region: 532-665
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000177
Family Spectrin repeat 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000012172   Gene: ENSNLEG00000009985   Transcript: ENSNLET00000012768
Sequence length 1719
Comment pep:known_by_projection supercontig:Nleu1.0:GL397322.1:4789365:4814552:-1 gene:ENSNLEG00000009985 transcript:ENSNLET00000012768 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PSASARSISNKELSELIEQLQKNADQVEKNIVDTEAKLQSPYADLSHHRSVLPDFELLNT
SLPQLDILFLIRQLKERVTNLRGKHRQIYSLAVKEVDPQVNWAALVEEKLDKLSSQSFGT
DLPLVDHQVEEHNIFHNEVKAIGPHLAKDGDKEQNSELRAKHQKLLAASQARQQHLSSLQ
DYMQRCTNELYWLDQQAKGRMQYDWSDRNLDYPSRRRQYENFINRNLEAKEERINKLHSE
GDQLLAAEHPGRNSIEAHMEAVHADWKEYLNLLICEESHLKYMEDYHQFHKDMKDAQELL
RKVDSDLNQKYGPDFKDRYQIELLLRELDDQEKVLDKYEDVVRGLQKRGQQVVPLKYRRE
TPLKPIPVEALCDFEGEQGLISRGYSYTLQKNNGESWELMDSAGNKLIAPAVCFVIPPTD
PEALALADSLGSQYQSVRQKAAGSKRRLQQRYEVLKTENPGDASDLQGRQVLAGLDKVAS
DLDRQEKAITGILRPPLEQGRAVQDSAERAKDLKNITNELLQIEPEKTRSTAEGEAFIQA
LPGSGTTPLLRTRVEDTNRKYERLVQLLDLAQEKVDVANRLEKSLQQGWELLATHENHLN
QDDTVPESSHILDSKGQELAAMASELQAQKSLLGEVERNLQAAKQCSSTLASRFQEHCPD
LERQEAEVHKLGQRFDNLSQQVERRAQSLQSAKVAYEDFRHGHDHVLQFLASIPSYEPQE
TDSLSQMETKLKNQKNLLDEIASREQEVQKICANSQQYQQAVKDYELEAEKLRSLLDLEN
GRSSHMSKRARLQSPAAKVKEEEAALAAKFTEVYAINRQRLQNLEFALNLLRQQPEVEVT
YETLQRNRPASGVEEAWKIRKELDEETERRQQLENEVTSTQEEIRTLRNQGPQESVVRKE
VLKKVPDPMLEESFQQLQRTLAEEQHKNQLLQEELEALHLQLHALEQETRDGGQEYVVKE
VLRIEPDRAQADEVLQLREELEALRRQKGAREAEVLLLQQHVAALAEEKSRAQEKVTEKE
VVKLQNDPQLEAEYQQLQEDHQHQGQLREKQEEELSFLQDKLKRLEKERAMAEGKITVKE
VLKVEKDAATEREVSDLTRQYEDEAAKARASQREKTELLRKIWALEEENAKVVVQEKVRE
IVRPDPKVESEVANLRLELVEQERKYRGAEEQLRSYQSELEALRRRGPQVEVKEVTKEVI
KYKTDPEMEKELQRLREEIVDKTRLIERCDLEIYQLKKEIQALKDTKPQVQTKEVVQEIL
QFQEDPQTKEEVASLRAKLSEEQKKQVDLERERASQEEQIARKEEELSRIPRVVQQEVVR
YEEEPGLRAEVSAFAESIDMELRQIDKLRAELRRLQRRRTELERQLEELERERQARREAE
REVQRLQQRLAALEQEEAEAREKVTRKQKVVLQQDPQQAREHALLRLQLEEEQHRRQLLE
GELETLRRKLATLEKADVKEKVVLSESVQVEKGDTEQEIQRLRSSLEEESRSKRELDVEV
SRLEARLSELEFHNSKSSKELDFLREENHKLQLERQNLQLETRRLQSEIDMAATETRDLR
NMTVADSGTNHDSRLWSLERELDDLKRLSKDKDLEIDELQKRLGSVAVKREQRENHLRRS
IVVIHPDTGRELSPEEAHRAGLIDWNMFVKLRSQECDWEEISVKGPNGESSVIHDRKSGK
KFSIEEALQSGRLTPAQYDRYVNKDMSIQELAVLVSGQK
Download sequence
Identical sequences ENSNLEP00000012172 ENSNLEP00000012172

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]