SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000012185 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000012185
Domain Number 1 Region: 32-79
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 1.66e-16
Family Ovomucoid domain III-like 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000012185   Gene: ENSNLEG00000009998   Transcript: ENSNLET00000012781
Sequence length 79
Comment pep:known_by_projection supercontig:Nleu1.0:GL397305.1:15492657:15499786:-1 gene:ENSNLEG00000009998 transcript:ENSNLET00000012781 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKVTGIFLLSALALLSLSGNTGADSLGREAKCYNELNGCTKIYDPVCGTDGNTYPNECVL
CFENQKRQTSILIQKSGPC
Download sequence
Identical sequences G1RG35
ENSNLEP00000012185 XP_003266649.1.23891 ENSNLEP00000012185

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]