SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000012221 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000012221
Domain Number 1 Region: 13-103
Classification Level Classification E-value
Superfamily DEATH domain 4.66e-21
Family Caspase recruitment domain, CARD 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000012221   Gene: ENSNLEG00000010023   Transcript: ENSNLET00000012818
Sequence length 233
Comment pep:known_by_projection supercontig:Nleu1.0:GL397278.1:18093400:18104835:-1 gene:ENSNLEG00000010023 transcript:ENSNLET00000012818 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPTAPSLTEEDLTEVKKDALENLRVYLCEKIIAERHFDHLRAKKILSREDTEEISCRTS
SRKRAGKLLDYLQENPKGLDTLVESIRREKTQNFLIQKITDEVLKLRNIKLEHLKGLKCS
SCEPFPDGATNSLSRSNSDESNFSEKLRASTVMYHPEGESSTTPFFSTNSSLNLPVLEVG
RTENTIFSSTTLPRPGDPGAPPLPPDLQLEEEGTCGNSSEMFLPLRSRTVSRQ
Download sequence
Identical sequences XP_003260053.1.23891 ENSNLEP00000012221 ENSNLEP00000012221

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]