SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000012248 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000012248
Domain Number 1 Region: 162-358
Classification Level Classification E-value
Superfamily vWA-like 3.06e-55
Family Integrin A (or I) domain 0.00036
Further Details:      
 
Domain Number 2 Region: 841-1046
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.56e-28
Family Laminin G-like module 0.06
Further Details:      
 
Domain Number 3 Region: 649-822
Classification Level Classification E-value
Superfamily Fibronectin type III 2.71e-21
Family Fibronectin type III 0.00082
Further Details:      
 
Domain Number 4 Region: 379-538
Classification Level Classification E-value
Superfamily Fibronectin type III 3.6e-18
Family Fibronectin type III 0.002
Further Details:      
 
Domain Number 5 Region: 557-644
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000252
Family Fibronectin type III 0.0016
Further Details:      
 
Domain Number 6 Region: 33-103
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000118
Family Fibronectin type III 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000012248   Gene: ENSNLEG00000010011   Transcript: ENSNLET00000012845
Sequence length 1316
Comment pep:known_by_projection supercontig:Nleu1.0:GL397482.1:676505:716641:1 gene:ENSNLEG00000010011 transcript:ENSNLET00000012845 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSGAPAHLGLCLWLWLGATLGRQQGQASGLLRLSVLPEDRLQMKWRESEGSGLGYLVQV
KPMAGDSEQEVILTTKTPKATVGGLSPSKGYTLQIFELTGSGRLLLARREFVIEDLKSSS
LDRSSQRPLGSGAPEPTPSHVGSPDPEQASEPRVASAPSQDPPTPAGPHFRCLPPVPADM
VFLVDGSWSIGHSHFQQVKEFLASVIAPFEIGPDKVQVGLTQYSGDAQTEWDLNSLGTKE
QVLAAVHRLRYKGGNTFTGLALTHVLGQNLQPAAGLRPEAAKVVILVTDGKSQDDVHTAA
RVLKDLGVNVFAVGVKNADEAELRLLASPPRDITVHNVLDFLQLGALAGLLSRLICQMLQ
GGSPRQGPAVAPALDTLPAPTSLVLSQVTSSSIRLSWTPAPQLPLKYLIVWRASRGGTPR
EVVVEGPAASMELHSLASRTEYLVSVFPVYEGGVGEGLRGLVTTAPLPPPRALTLAAVTP
RTVHLTWQPSAGATRYLVRCSPASPKGEEEEREVQVGRPEVLLDGLEPGRDYEVSVQSLR
GPEGSEARGIRARTPALAPLRHLGFSDVSHNTARVFWEGAPRPVRLVRVTYASSEGGHSG
QTEAPGNATSATLGPLSSSTTYTVRVTCLYPGGGSSTLTGRVTTKKAPSPSQLSVTELPG
DAVQLAWVAAAPSGVLVYQIKWTPLGEGKAREISVPGNLGTAILPGLGRHTEYDVTILAY
YRDGARSDPVSLRYTPSTVSRSPPSNLALASETPDSLQVSWTPPLGRVLHYWLTYAPASG
LGPEKSVSVPGPRSHVTLPDLQAATKYRVLVSAVYAAGRSEAVSATGQTACPALRPNGSL
PGFDLMMAFGLVEKAYASIRGVAMEPSAFGGTPTFTLFKDAQLTRRVSDVHPAPLPPEHT
IVFLVRLLPETPREAFALWQMTAEDFQPLLGVLLDAGRKSLTYFHRDPRAALQEATFDPQ
EVRKIFFGSFHKVHVAVGRSKVRLYVDCRKVAERPLGEVGSPPAAGFVTLGRLAKARGPR
SSSATFQLQTLQIVCSDTWADEDRCCELPASKDGETCPAFVSACSCSSETPGPPGPQGPP
GLPGRNGTPGEQGFPGPRGEPGPPGQMGPEGPGGQQGSPGTQGRTVQGPVGPPGVKGEKG
DHGLPGLQGHPGHQGIPGRVGLQGPKGMRGLEGTAGLPGPPGPRGFQGMAGARGTSGERG
PPGAVGPTGLPGPKGERGEKGEPQSLATLYQLVSQASHVSKFDSFYENTRPPMPILEQKL
EPGTEPLGSPGTHSEALLPGEWGRGGRHLESRGEPGAVGQTASPGQQGASTQGLWE
Download sequence
Identical sequences ENSNLEP00000012248 ENSNLEP00000012248

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]