SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000012267 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000012267
Domain Number 1 Region: 628-675
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 5.41e-17
Family Serine proteinase inhibitor lekti 0.0042
Further Details:      
 
Domain Number 2 Region: 770-817
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 1.15e-16
Family Serine proteinase inhibitor lekti 0.0052
Further Details:      
 
Domain Number 3 Region: 491-538
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 4.44e-16
Family Serine proteinase inhibitor lekti 0.0062
Further Details:      
 
Domain Number 4 Region: 561-611
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 5.27e-16
Family Serine proteinase inhibitor lekti 0.0011
Further Details:      
 
Domain Number 5 Region: 941-988
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 7.76e-16
Family Serine proteinase inhibitor lekti 0.014
Further Details:      
 
Domain Number 6 Region: 222-270
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 9.01e-16
Family Serine proteinase inhibitor lekti 0.0071
Further Details:      
 
Domain Number 7 Region: 92-152
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000000018
Family Ovomucoid domain III-like 0.016
Further Details:      
 
Domain Number 8 Region: 293-342
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000000263
Family Serine proteinase inhibitor lekti 0.0016
Further Details:      
 
Domain Number 9 Region: 158-205
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000000136
Family Serine proteinase inhibitor lekti 0.0067
Further Details:      
 
Domain Number 10 Region: 702-751
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000000152
Family Serine proteinase inhibitor lekti 0.023
Further Details:      
 
Domain Number 11 Region: 432-479
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000000166
Family Serine proteinase inhibitor lekti 0.0014
Further Details:      
 
Domain Number 12 Region: 364-410
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000000018
Family Serine proteinase inhibitor lekti 0.00046
Further Details:      
 
Domain Number 13 Region: 844-894
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000000347
Family Serine proteinase inhibitor lekti 0.0036
Further Details:      
 
Domain Number 14 Region: 1021-1076
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000000152
Family Ovomucoid domain III-like 0.015
Further Details:      
 
Domain Number 15 Region: 26-75
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000735
Family Serine proteinase inhibitor lekti 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000012267   Gene: ENSNLEG00000010008   Transcript: ENSNLET00000012865
Sequence length 1093
Comment pep:known_by_projection supercontig:Nleu1.0:GL397305.1:15717601:15795132:1 gene:ENSNLEG00000010008 transcript:ENSNLET00000012865 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKIATVLVLLPLALCLIQDAASENEDQEICHEFQAFMKNGKLFCPQDKKFFQSLDGIMFI
NKCATCKMILEKESKSQKRGRHLARATKATAPTELNCDDFKKGERDGDFICPDFYEAVCG
TDGKTYGNRCALCAENAKTGSQIGVKSEGECKSSNPEQDVCSAFRPFVKDGRLGCTREND
PVLGPDGKTHGNKCVMCAELFLKEAENAKREGETRIRRNAEKDFCKEYEKQVRNGRLFCT
RESDPVRGPDGRMHGNKCALCAEIFKRRFSEENSKTDQNLGKAEEKTKVKREIVKLCSEY
QNQAKNGILFCTRENDPIRGPDGKMHGNLCSMCQAYFQAENEEKKKAEAQARNKRESGKA
TSYAELCSEYRKLVRNGKLACTRENDPIQGPDGRVHGNTCSMCEVFFQAEEEKKKKEGES
GNKRQSKSTASFEKLCGEYRKSRNNGRLFCTRENDPIQGPDGKMHGNTCSMCEAFFQQEE
RARAKAKREAAKEICSEFQDQVRNGTLICTREHNPVRGPDGKMHGNKCAMCASMFKLEEE
EKKNNKEEKGKVEAEKVKREAVQELCSEYRHYVRNGRLPCTRENDPIEGPDGKIHGNTCS
MCEAFFQQEAKEKERAEPRAKVKREAEKETCDEFRSLLQNGKLFCTRENDPVRGPDGKTH
GNKCAMCKAVFQKEDEERKRKEEKDQRNAAGHGSSGGGGGNTQDECAEFREQMKNGRLSC
TRESDPVRDADGKSYNNQCTMCKAKLEREAERKNDYSRSRSNGTGSESGKDTCDEFRSQM
KNGKLICTRESDPVRGPDGKTHGNKCTMCKEKLEREAAEKKKKEDEGRSNTGERSNDKEV
IDVRHDLCREFRSMQRNGKLICTRENNPVRGPYGKMHINKCAMCQSIFDREANERKKKDE
EKSSSKPSNNAKDQCRQVQNEAEDAKFRQPVRSLASVARISTDECSEFRNYVRNNELICS
RENDPVRGADGKFYTNKCYMCRAVFLTEALERAKLQEKPSHVRAFQEEDSPDSFSSLDSE
MCKDYRVLPRIGYLCPKDLKPVCGDDGQTYNNPCMLCHENLIRQTNTHIRSTGKCEESST
PGTTAASMPPSDE
Download sequence
Identical sequences ENSNLEP00000012267 ENSNLEP00000012267

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]