SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000012276 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000012276
Domain Number 1 Region: 64-126
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000000222
Family Ovomucoid domain III-like 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000012276   Gene: ENSNLEG00000010067   Transcript: ENSNLET00000012874
Sequence length 127
Comment pep:known_by_projection supercontig:Nleu1.0:GL397305.1:15916676:15934162:1 gene:ENSNLEG00000010067 transcript:ENSNLET00000012874 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EQQLFSRLVVTRAGPHSATSSRPYQRRVLYEMKWLPFPHKIIFFLVCSTLTHVAFSGIFK
RRDFTRWPKPRCKMYIPLDPDYDADCPNVTAPVCASNGRTFQNECFFCVEQREFHYRIKF
EKYGKCD
Download sequence
Identical sequences ENSNLEP00000012276

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]