SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000012283 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000012283
Domain Number 1 Region: 29-85
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000000152
Family Ovomucoid domain III-like 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000012283   Gene: ENSNLEG00000010071   Transcript: ENSNLET00000012881
Sequence length 85
Comment pep:known_by_projection supercontig:Nleu1.0:GL397305.1:15973140:15976619:1 gene:ENSNLEG00000010071 transcript:ENSNLET00000012881 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKITEGLLLLCTVVYFCSSSEAASLSPKKVDCSIYKKYPVVAIPCPITYLPVCGSDYITY
GNECHLCTESLKSNGRVQFLHDGNC
Download sequence
Identical sequences G1RGD3
ENSNLEP00000012283 XP_003266657.1.23891 ENSNLEP00000012283

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]