SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000012288 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000012288
Domain Number 1 Region: 28-86
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 7.62e-17
Family Ovomucoid domain III-like 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000012288   Gene: ENSNLEG00000010076   Transcript: ENSNLET00000012886
Sequence length 86
Comment pep:known_by_projection supercontig:Nleu1.0:GL397305.1:15994647:15998914:1 gene:ENSNLEG00000010076 transcript:ENSNLET00000012886 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRATAIVLLLALTLATMFSIECAKQTKQMVDCSHYKKLPPGQQRFCHHMYDPICGSDGKT
YKNDCFFCSQVKKTDGKLKFVHFGKC
Download sequence
Identical sequences G1RGD8 G3SJ32 H2PH02 H2R588
ENSGGOP00000028122 ENSGGOP00000028122 ENSPPYP00000017816 ENSNLEP00000012288 9598.ENSPTRP00000047923 9600.ENSPPYP00000017816 ENSNLEP00000012288 ENSPTRP00000047923 ENSPPYP00000017816 XP_001143757.1.37143 XP_002816101.1.23681 XP_003266658.1.23891 XP_003829108.1.60992 XP_004042826.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]