SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000012293 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000012293
Domain Number 1 Region: 219-307
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000956
Family Fibronectin type III 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000012293   Gene: ENSNLEG00000010080   Transcript: ENSNLET00000012891
Sequence length 320
Comment pep:known_by_projection supercontig:Nleu1.0:GL397482.1:955476:959247:1 gene:ENSNLEG00000010080 transcript:ENSNLET00000012891 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSHVAGLGLDKMKLGKPQSFLDPEEADDQQLLEPEAWGTYTERRNALREFLTSDLSPHL
LKRHHARMQLLRKCSYYIEVLPKHLALGDQNPLMLPSAVFQLIDPRKFQRMKKVGTAQTK
IQLLLLGDLLEQLDHGRAELDALLQSPDPRPFLADWALVERRLADVSAVMDSFLTMMVPG
RLHVKHRLVSEVSAAKIPHIWLMLGTKMPVVFDRKESAAHQDWARLRWFVAIQPATSEQY
ELRFRLLDPRTQQECAQCGVIPVAACTFDVRNLLPNRSYKFTIKRAETSTLVYEPWRDSL
TLQTKPEPWRGPPSATLSER
Download sequence
Identical sequences ENSNLEP00000012293 ENSNLEP00000012293

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]