SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000012304 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000012304
Domain Number 1 Region: 136-302
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 9.94e-28
Family Toll/Interleukin receptor TIR domain 0.00073
Further Details:      
 
Domain Number 2 Region: 1-90
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000354
Family I set domains 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000012304   Gene: ENSNLEG00000010091   Transcript: ENSNLET00000012903
Sequence length 437
Comment pep:known_by_projection supercontig:Nleu1.0:GL397281.1:27351620:27390908:1 gene:ENSNLEG00000010091 transcript:ENSNLET00000012903 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GDSANLTCRAFFGYSGDVSPLIYWMKGEKFIEDLDENRVWESDIRILKEHLGEQEVSISL
IVDSVEEGDLGNYSCYVENGNGRRHASVLLHKRELMYTVELAGGLGAILLLLVCLVTIYK
CYKIEIMLFYRNHFGAEELDGDNKDYDAYLSYTKVDPDQWNQETGEEERFALEILPDMLE
KHYGYKLFIPDRDLIPTGTYIEDVARCVDQSKRLIIVMTPNYVVRRGWSIFELETRLRNM
LVTGEIKVILIECSELRGIMNYQEVEALKHTIKLLTVIKWHGPKCNKLNSKFWKRLQYEM
PFKRIEPITHEQALDVSEQGPFGELQTVSAISMAAATSTALATAHPDLRSTFHNTYHSQM
RQKHYYRSYEYDVPPTGTLPLTSIGNQHTYCNIPMTLINGQRPQTKSSREQNPDEAHTNS
AILPLLPRETSISSVIW
Download sequence
Identical sequences A0A0A0MR17 A0A2J8L3D9 A0A2J8WJ76 A0A2K5Y8X3 A0A2K6CR44 D2H5T1 F1PYR3 F7IJ18 G3SU49 H0X9X2 W5Q9A4
ENSOGAP00000012392 ENSPTRP00000037316 ENSLAFP00000003644 ENSCJAP00000014102 ENSOGAP00000012392 ENSCAFP00000020084 ENSNLEP00000012304 ENSCJAP00000014102 ENSPTRP00000037316 ENSNLEP00000012304 ENSLAFP00000003644 9823.ENSSSCP00000012983 ENSOARP00000019296 ENSCAFP00000020084 ENSP00000305200

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]