SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000012331 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSNLEP00000012331
Domain Number - Region: 570-666
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000126
Family Fibronectin type III 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000012331   Gene: ENSNLEG00000010115   Transcript: ENSNLET00000012930
Sequence length 677
Comment pep:known_by_projection supercontig:Nleu1.0:GL397322.1:10278509:10325491:1 gene:ENSNLEG00000010115 transcript:ENSNLET00000012930 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASPDRSKRKILKAKKTMPQSCRKQVEMLNKSRNVEALKTAAIGSNVPSGNQSFSPSVIT
TKCSPSENGASSLDSNKNSVSEKSKVFSQNCIKPIEEIVHSETKLEQVVCSYQKPSKTTE
SPSRVFTEEAKDSLNTSENDSEYQRNVTRSLFEHEGACSLKSSCCPPSVLSDVVQMPEST
VTSTVGDKKTDQMAFHLETNSNSESHDKKQSDILCSEDSGFVPVEKTPNLVNSVTSNNCA
DDILKTDDCSRTSISNCESADSTWQSSLDTNNNSHYQKKRMFSENEENVKRMKTSEQINE
NICVSLETQTAFLEQVRHLIQQEIHSVSYELFDKKLKELNQRIGKTECRNKHEGIADKLL
AKIAKLQRRIKTVLLFQRSCLKPNMLSSNGACKVANSEAIILDKNLESVNSPIEKSSVNY
EPSNPSEKGSKKINLSPDQNKSVSESNNDDVMLISVESPNLTTPITSNPTDTRKITSGNS
SNSPNAEVMAVQKKLDSIIDLTKEGLSNCNTESPVSHLESHSKAVSNSKETTPLAQNAAQ
VPESFEHLPPLPEPPGPLPELVDKTRDTLPPQKPELKVKRVFRPNGIALTWNITKINPKC
APVESYHLFLCHENSHNKLIWKKIGEIKALPLPMACTLSQFLASNRYYFTVQSKDIFGRY
GPFCDIKSIPGFSENLT
Download sequence
Identical sequences G1RGI1
XP_003269316.1.23891 XP_012352564.1.23891 ENSNLEP00000012331

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]