SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000012378 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000012378
Domain Number 1 Region: 307-470
Classification Level Classification E-value
Superfamily vWA-like 3.42e-25
Family Integrin A (or I) domain 0.007
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000012378
Domain Number - Region: 752-794
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000999
Family Fibronectin type III 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000012378   Gene: ENSNLEG00000010144   Transcript: ENSNLET00000012981
Sequence length 914
Comment pep:known_by_projection supercontig:Nleu1.0:GL397278.1:19301059:19334449:1 gene:ENSNLEG00000010144 transcript:ENSNLET00000012981 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPFKSSVFILILHLLEGALSNSLIQLNNNGYEGIVVAIDPNVPEDETLLQQIKDMVTQA
SPYLFEATGKRFYFKNVAILIPETWQTKADYVRPKLETYKNADVLVAESTPPGNDEPYTE
QMGNCGEKGERIHLTPDFIAGKKLREYGPQGRAFVHEWAHLRWGVFDEYNNDEKFYLSNG
RIQAVRCSAGITGTNVVKKCQGGSCYTKRCTFNKVTGLYEKGCEFVLQSHQTEKASIMFA
QHVDSVVEFCTEQNHNKEAPNKQNQKCSLRSTWEVIRDSEDFKKTTPMTTQPPNPTFSLL
QIGQRIVCLVLDKSGSMATGNRLNRLNQAGQLFLLQTVELGSWVGMVTFDSAAHVQSELI
QINSGSDRDTLAKRLPAAASGGTSICRGLRSAFTVIKKKYPTDGSEIVLLTDGEDNTISE
CFNEVKQSGAIIHTVALGPSAAQELEELSKMTGGLQTYASDQVQNNGLIDAFGALSSGNG
AVSQRSIQLESKGLTLQNSQWMNGTVIVDSTVGKDTLFLITWTTQPPQILLWDPSGQKQG
GFVVDKNTKMAYLQIAGIAKVGTWKYSLQASSQTLTLTVTSRASNATLPPITVTSKMNKD
AGKFPSPMIVYANIRQGASPILRASVTALIESVNGKTVTLELLDNGAGADATKDDGVYSR
YFTTYDTNGRYSVKVRALGGVNAARWREIPQQSGALYIPGWIENDEIQWNPPRPEINKDD
VQHKQVCFSRTSSGGSFVASDVPNAPIPDLFPPGQITDLKAEIHGSSLINLTWTAPGDDY
DHGTAHKYIIRISTSILDLRDKFNESLQVNTTALIPKEANSEEVFLFKPENITFENGTDL
FIAIQAVDKVDLKSEISNIARVSLFIPPQTPPETPSPDEMSAPCPNIHINSTIPGIHILK
IMWKWIGELQLSIA
Download sequence
Identical sequences G1RGM8
ENSNLEP00000012378 XP_003260062.1.23891 ENSNLEP00000012378

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]