SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000012386 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000012386
Domain Number 1 Region: 218-252
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.0000602
Family Tudor domain 0.018
Further Details:      
 
Domain Number 2 Region: 174-199
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000675
Family CCCH zinc finger 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000012386   Gene: ENSNLEG00000010146   Transcript: ENSNLET00000012989
Sequence length 530
Comment pep:known_by_projection supercontig:Nleu1.0:GL397482.1:1113134:1131894:1 gene:ENSNLEG00000010146 transcript:ENSNLET00000012989 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDEESLGSALQTYRAQLQQVELALGAGLDSSEQADLRQLQGDLKELIELTEASLVSVRKS
RLLAALDEERPGRQEDAEYQALREAITEAVEAPAAAPGSGSETVPKAEAGPESMAGGQEE
EEGEDEEELSGTKVSAPYYSSWGTLEYHNAMVVGTEEAEDGSAGVRVLYLYPTHKSLKPC
PFFLEGKCRFKENCRFSHGQVVSLDELRPFQDPDLSSLQAGSACLAKHQDGLWHAARITD
VDNGYYTVKFDSLLLREAVVEGDGILPPLRTEATGSDSDSDGAGDSSYARGTAAAAQPRS
QAIALCPSLAVVGSDAVDSGTCSSAFAGWEVHTRGIGSRLLTKMGYEFGKGLGRHAEGRV
EPIHAVVLPRGKSLDQCLETLQKQTRVGKAGTNKPPRCRGRGARPGGRPPPRNVFDFLNE
KLQGQAPGLEAGAAPAGRRSKDMYHASKSAKRALSVRLFQTEEKIERTQRDIRSIQEALA
RNAGRHSVASAQLQEKLAGAQRQLGQLRAQEAGLQQEQRKADTHKKMTEF
Download sequence
Identical sequences ENSNLEP00000012386 ENSNLEP00000012386

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]