SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000012390 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000012390
Domain Number 1 Region: 28-148,190-346
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.11e-20
Family FAD-linked reductases, N-terminal domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000012390   Gene: ENSNLEG00000010166   Transcript: ENSNLET00000012993
Sequence length 494
Comment pep:known_by_projection supercontig:Nleu1.0:GL397305.1:17038579:17055493:1 gene:ENSNLEG00000010166 transcript:ENSNLET00000012993 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARAAQLLAALTALLAAAAAGGDAPPGKIAVVGAGIGGSAVAHFLQQHFGPRVQIDVYEK
GTVGGRLATISVNKQHYESGAASFHSLSLHMQDFVKLLGLRHRREVVGRSAIFGGEHFVL
EETDWYLLNLFRLWWHYGISFLRLQMWVEEVMEKFMRIYKYQAHGYAFSGVEELLYSLGE
STFVNMTQHSVAESLLQVGVTQRFIDDVVSAVLRASYGQSAAMPAFAGAMSLAGAQGSLW
SVEGGNKLVCSGLLKLTKANVIHATVTSVTLRSTEGKALYQVAYENEVGNSSDFYDIVVI
ATPMHLDNSSSNLTFAGFHPPIDDVQGSFQPTVVSLVHGYLNSSYFGFPDPKLFPFANIL
TTDFPSFFCTLDNICPVNISASFRRKQPQEAAVWRVQSPKPLFRTQLKTLFRSYYSVQTA
EWQAHPLYGSRPTLPRFALHDQLFYLNALEWAASSVEVMAVAAKNVALLAYNRWYQDLDK
IDQKDLMHKVKTEL
Download sequence
Identical sequences G1RGP0
ENSNLEP00000012390 ENSNLEP00000012390 XP_003266669.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]