SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000012400 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000012400
Domain Number 1 Region: 307-472
Classification Level Classification E-value
Superfamily vWA-like 3.66e-26
Family Integrin A (or I) domain 0.014
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000012400
Domain Number - Region: 747-816
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00216
Family Fibronectin type III 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000012400   Gene: ENSNLEG00000010158   Transcript: ENSNLET00000013005
Sequence length 921
Comment pep:known_by_projection supercontig:Nleu1.0:GL397278.1:19379868:19415904:1 gene:ENSNLEG00000010158 transcript:ENSNLET00000013005 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGFFRGFVFLLVLCLLHQSNTSFIRLNNNGFEDIIIVIDPSVPEDEKIIEQIEDMVTTAS
TYLFEATEKRFFFKNVSILIPENWKENPQYKRPKHENYKHADVIVAPPTLPGRDEPYTKQ
FTECGEKGEYIHFTPDLLLGKKQNEYGPPGKLFVHEWAHLRWGVFDEYNEDQPFYRAKSK
KIEATRCSAGISGRNRVYKCQGGSCLSRACRIDSTTKLYEKDCQFFPDKVQTEKASIMFM
QSIDSVVEFCNEKTHNQEAPSLQNIKCNFRSTWEVISNSEDFKNTIPMVTPPPPPVFSLL
KISQRIVCLVLDKSGSMGGYDRLNRMNQAAKHFLLQTVENGSWVGMVHFDTTATIVNKLI
QIKGSDERNTLMAGLPTYALGGTSICSGIKYAFQVIGELHSQLDGSEVVLLTDGEDNTAS
SCIDEVKQSGAIVHFIALGSAADEAVIEMSNITGGSHFYASDEAQNNGLIDAFGALTSGN
TDLSQKSLQLESKGLTLNSNPWMNDTVIIDSTVGKDTFFLITWNSLPPSISLWDPSGTIM
ENFTVDATSKMAYLSIPGTAKVGTWAYNLQAKANPETLTITVTSRAANSSVPPITVNAKM
NKDVNSFPSPMIVYAEILQGYVPVLGANVTAFIESQNGHTEVLELLDNGAGADSFKNDGV
YSRYFTAYTENGRYSLKVRAHGGANTASLRLQPPLNRAAYIPGWVVNGEIEANPPRPEID
EDTQTPLEDFSRTASGGAFVVSQVPSLPLPDLYPPSQITDLDATVLEDEIILTWTAPGDN
FDAGKVQHYIIRMSGSILDLRDSFNDALQVNTTDLSPKEANSKEIFAFKPENISEENATH
IFIAIKSIDKSNLTSKVSNIAQVTLFIPQANPDDIDPTPTPTPTPTPTPDKSHSSGVNIS
TLVLSVIGSVVIVNFILSTTI
Download sequence
Identical sequences G1RGQ0
ENSNLEP00000012400 XP_003260064.1.23891 ENSNLEP00000012400

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]