SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000012406 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000012406
Domain Number 1 Region: 36-333
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 8.51e-25
Family FAD-linked reductases, N-terminal domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000012406   Gene: ENSNLEG00000010176   Transcript: ENSNLET00000013012
Sequence length 505
Comment pep:known_by_projection supercontig:Nleu1.0:GL397287.1:23947567:23965902:1 gene:ENSNLEG00000010176 transcript:ENSNLET00000013012 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRAVAELVSSLLGLWLLLCSCGCPEGAELRAPPDKIAIIGAGIGGTSAAYYLRQKFGKD
VKIDLFEREEVGGRLATMRVQGQEYEAGGSVIHPLNLHMKRFVKDLGLSTVQASGGLLGI
YNGETLVFEESNWFIINVIKLVWRYGFQSLRMHMWVEDVLDKFMRIYRYQSHDYAFSSVE
KLLHALGGDDFLGMLNRTLLETLQKAGFSEKFLNEMIAPVMRVNYGQSTDINAFVGAVSL
SCSDSGLWAVEGGNKLVCSGLLQASKSNLISGSVMYIEEKTKTKHTGNPTKMYEVVYQIG
TETRSDFYDIVLVATPLNRKMSNITFLNFDPPIEEFHQYYQHIVTTLVKGELNTSIFSSR
PIDKFGLNTVLTTDNSDLFINSIGIVSSVREKEDPEPSTDGTYVWKIFSQETLTKAQILK
LFLSYDYAVKKPWLAYPHYKPPEKCPSIILHDRLYYLNGIECAASAMEMSAIAAHNAALL
AYHRWNGHTDMIDQDGLYEKLKTEL
Download sequence
Identical sequences A0A2I3GZ46
ENSNLEP00000012406 XP_003262564.1.23891 ENSNLEP00000012406

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]