SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000012408 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000012408
Domain Number 1 Region: 1-225
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 8.35e-79
Family Calponin-homology domain, CH-domain 0.000000899
Further Details:      
 
Domain Number 2 Region: 985-1141
Classification Level Classification E-value
Superfamily Spectrin repeat 1.92e-23
Family Spectrin repeat 0.0051
Further Details:      
 
Domain Number 3 Region: 1092-1252
Classification Level Classification E-value
Superfamily Spectrin repeat 2.3e-19
Family Spectrin repeat 0.0063
Further Details:      
 
Domain Number 4 Region: 325-435
Classification Level Classification E-value
Superfamily Spectrin repeat 2.75e-18
Family Spectrin repeat 0.0033
Further Details:      
 
Domain Number 5 Region: 1202-1356
Classification Level Classification E-value
Superfamily Spectrin repeat 1.06e-17
Family Spectrin repeat 0.0038
Further Details:      
 
Domain Number 6 Region: 511-649
Classification Level Classification E-value
Superfamily Spectrin repeat 3.91e-16
Family Spectrin repeat 0.0039
Further Details:      
 
Domain Number 7 Region: 1510-1665
Classification Level Classification E-value
Superfamily Spectrin repeat 4.4e-16
Family Spectrin repeat 0.0055
Further Details:      
 
Domain Number 8 Region: 1619-1763
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000374
Family Spectrin repeat 0.0067
Further Details:      
 
Domain Number 9 Region: 1814-1958
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000248
Family Spectrin repeat 0.0051
Further Details:      
 
Domain Number 10 Region: 444-545
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000396
Family Spectrin repeat 0.0044
Further Details:      
 
Domain Number 11 Region: 765-921
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000775
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number 12 Region: 2042-2132
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000192
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 13 Region: 1419-1546
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000496
Family Spectrin repeat 0.0072
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000012408
Domain Number - Region: 1328-1419
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0374
Family Spectrin repeat 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000012408   Gene: ENSNLEG00000010142   Transcript: ENSNLET00000013014
Sequence length 2137
Comment pep:novel supercontig:Nleu1.0:GL397281.1:29720544:30548912:-1 gene:ENSNLEG00000010142 transcript:ENSNLET00000013014 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EREDVQKKTFTKWVNAQFSKFGKQHIENLFSDLQDGRRLLDLLEGLTGQKLPKERGSTRV
HALNNVNKALRVLQNNNVDLVNIGSTDIVDGNHKLTLGLIWNIILHWQVEKVMKNIRGGL
QQTNSEKILLSWVRQSTRNYPQVNVINFTTSWSDGLALNALIHSHRPDLFDWNSVVCQQS
ATQRLEHAFNIARCQLGIEKLLDPEDVATTYPDKKSILMYITSLFQVLPQQVSIEAIQEV
EMLPRPPKVTKEEHFQLHHQMQYSQQITVSLAQGYERTSSPKPRFKSYAYTQAAYVTTSD
PTRSPFPSQHLEAPEDKSFGSSLMESEVNLDRYQTALEEVLSWLLSAEDTLQAQGEISND
VEVVKEQFHTHEGYMMDLTAHQGRVGNILQLGSKLIGTGKLSDDEETEVQEQMNLLNSRW
ECLRVASMEKQSNLHRVLMDLQNQKLKELNDWLTKTEERTRKMEEEPLGPDLEDLKRQVQ
QHKVLQEDLEQEQVRVNSLTHMVVVVDESSGDHATAALEEQLKVLGDRWANICRWTEDRW
VLLQDILLKWQRLTEEQCLFSAWLSEKEDAVNKIHTTGFKDQNEMLSSLQKLAVLKADLE
KKKQSMGKLYSLKQDLLSTLKNKSVTQKTEAWLENFARCWDNLVQKLEKSTAQISQAVTT
TQPSLTQTTVMETVTMVTTREQILVKHAQEELPPPPPQKKRQMTVDSEIRKRLDVDITEL
HSWITRSEAVLQSPEFAIYRKEGNFSDLKEKVNAIEREKAEKFRKLQDASRSAQALVEQM
VNEGVNADSIKQASEQLNSRWIEFCQLLSERLNWLEYQSNIITFYNELQQLEQMTTTAEN
WLKIQPTTPSEPTAIKSQLKICKDEVNRLSALQPQIERLKIQSIALKEKGQGPMFLDADF
VAFTNHFNQVFSDVQAREKELQTIFDTLPPMRYQETMSAIRTWVQQSETKLSIPQLSVTD
YEIMEQRLGELQALQGSLQEQQSGLNYLSTTVKEMAKKAPSEISRKYQLEFEEIEGRWKK
LSSQLVEHCQKLEDQMNKLRKIQNHIQTLKKWMAEVDVFLKEEWPALGDSEILKKQLKQC
RLLVNDIQTIQPSLNSVNEGGQKIKNEAEPEFASRLEIELKELNTQWDHMCQQVCARKEA
LKGGLEKTVSLQKDLSEMHEWMTQAEEEYLERDFEYKTPDELQKAVEEMKRAKEEAQQKE
AKVKLLTESVNSVIAQAPPVAQEALKKELETLTTNYQWLCTRLNGKCKTLEEVWACWHEL
LSYLEKANKWLNEVEFKLKTTENIPGGAEEISEVLDSLENLMRHSEDNPNQIRILAQTLT
DGGVMDELINEELETFNSRWRELHEEAVRRQKLLEQSIQSAQEIEKSLHLIQESLTSIDK
QLEAYIADKVDAAQMPQEAQAIKIQSDLTSHEISLEEMKKHNQGKEAAQRVLSQIDVAQK
KLQDVSMKFRLFQKPANFEQRLQESKMILDEVKMHLPALETKSVEQEVVQSQLNHCVNLY
KSLSEVKSEVEMVIKTGRQIVQKKQTENPKELDERVTALKLHYNELGAKVTERKQQLEKC
LKLSRKMRKEMNVLTEWLAATDMELTKRSAVEGMPSNLDSEVAWGKATQKEIEKQKVHLK
SITEVGEALKAVLGKKETLVEDKLSLLNSNWIAVTSRAEEWLNLLLEYQKHMETFDQNVD
HITKWIIQADTLLDESEKKKPQQKEDVLKRLKAELNDIRPKVDSTRDQAANLMANRGDHC
RKLVEPQISELNHRFAAISHRIKTGKASIPLKELEQFNSDIQKLLEPLEAEIQQGVNLKE
EDFNKDMNEDNEGTVKELLQRGDNLQQRITDERKREEIKIKQQLLQTKHNALKDLRSQRR
KKALEISHQWYQYKRQADDLLKCLDDIEKKLASLPEPRDERKIKEIDRELQKKKEELNAV
RRQAEGLSEDGAAMAVEPTQIQLSKRWREIESKFAQFRRLNFAQIHTVREETMMVMTEDM
PLEISYVPSTYLTEITHVSQALSEVEQLLNAPDLCAKDFEDLFKQEESLKNIKDSLQQSS
GRIDIIHSKKTAALQSATPVERVKLQEALSQLDFQWEKVNKMYKDRQGRFDRSVEKWRRF
HYDIKIFNQWLTEAEQFLRKTQIPENWEHAKYKWYLK
Download sequence
Identical sequences ENSNLEP00000012408

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]