SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000012430 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000012430
Domain Number 1 Region: 29-194
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 9.45e-37
Family MHC antigen-recognition domain 0.0000000186
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000012430   Gene: ENSNLEG00000010201   Transcript: ENSNLET00000013037
Sequence length 238
Comment pep:known_by_projection supercontig:Nleu1.0:GL397356.1:6752674:6757844:1 gene:ENSNLEG00000010201 transcript:ENSNLET00000013037 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLTTLLPILLLSGWAFCSQDASDGESGAHLLQISYFRDPYHVWYQGNASLGGHLTHVLEG
PSTNTTIIQLQPLQEPESWVRTQSGLQSYLLQFHSLVRLVHQERTLAFPLTIRCFLGCEL
PPEGSRAHVFFEVAVNGSSFVSFRPERALWQADTQVTSGVVTFVLQQLNAYNRTRYELRE
FLEDTCVQYVQKHISAENTKGSQTSRSYTSLVLGVLVGSFIIAGVAVGIFLCTGGRRC
Download sequence
Identical sequences ENSNLEP00000012430 ENSNLEP00000012430

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]