SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000012442 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000012442
Domain Number 1 Region: 572-602,641-719
Classification Level Classification E-value
Superfamily SpoIIaa-like 4.32e-16
Family Anti-sigma factor antagonist SpoIIaa 0.008
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000012442
Domain Number - Region: 199-267
Classification Level Classification E-value
Superfamily Dhaf3308-like 0.0536
Family Dhaf3308-like 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000012442   Gene: ENSNLEG00000010209   Transcript: ENSNLET00000013049
Sequence length 739
Comment pep:known_by_projection supercontig:Nleu1.0:GL397305.1:17647560:17670500:1 gene:ENSNLEG00000010209 transcript:ENSNLET00000013049 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSESKEQHDLSPRDSAEGNDSYPSGIHLELQRESSTDFKQFETNDQCRPYHRVLIERQE
KSDTNFKEFVIKKLQKNCQCSPAKAKNMILGFLPVLQWLPKYNLKKNILGDVMSGLIVGI
LLVPQSIAYSLLAGQEPVYGLYTSFFASIIYFLLGTSRHISVGIFGVLCLMIGETVDREL
QKAGYDNAHRASSLGMVSNGSTLLNHTSDRICDKSCYAIMVGSSVTFIAGVYQVAMGVFQ
VGFVSVYLSDALLSGFVTGASITILTSQAKYLLGLNLPRSNGVGSLITTWIHVFRNIHKT
NLCDLITSLLCLLVLLPTKELNEHFKSKLKAPIPVELVVVVAATLASHFGKLHENYNSSI
AGHIPTGFMPPKVPEWNLIPSVAVDAIAISIIGFAITVSLSEMFAKKHGYTVKANQEMYA
IGFCNIIPSFFHCFTTSAALAKTLVKESTGCHTQLSGVVTALVLLLVLLVIAPLFYSLQK
SVLGVITIVNLRGALRKFRDLPKMWSISRMDTVIWFVTMLSSALLSTEIGLLVGVCFSMF
CVILRTQKPKSSLLGLVEESEVFESVSAYKNLQTKPGIKIFRFVAPLYYINKECFKSALY
KQTVNPVLIKVAWKKAAKRKIKEKVVTPGGIQDEMSVQLSHDPLELHTIVIDCSAIQFLD
TAGIHTLKEVRRDYEAIGIQVLLAQCNPSVRDSLTKGEYCKKEEENLLFYSVYEAMAFAE
VSKNQKGICVPNGLSLSSD
Download sequence
Identical sequences G1RGU2
XP_003266680.1.23891 ENSNLEP00000012442 ENSNLEP00000012442

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]