SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000012462 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000012462
Domain Number 1 Region: 193-323
Classification Level Classification E-value
Superfamily C-type lectin-like 3.67e-41
Family C-type lectin domain 0.00027
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000012462
Domain Number - Region: 74-206
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.000243
Family HBL-like 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000012462   Gene: ENSNLEG00000010226   Transcript: ENSNLET00000013071
Sequence length 328
Comment pep:known_by_projection supercontig:Nleu1.0:GL397287.1:24516180:24521803:-1 gene:ENSNLEG00000010226 transcript:ENSNLET00000013071 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTVEREAPDAHFTVDKQNISLWPREPPPKSGPSLLPGKTPTVRAALICLTLVLVASILLQ
AVLYPWFMGTISDVKTNVQLLKGRVDNISTLDSEIKKNSDGMEAAGVQIQMVNVSLGYVL
SQFLELKTSVEKANAQIQILTRSWEEVSTLNAQIPELKSDLEKASALNTKIRALQGSLEN
MSKLLKRQNDILQVVSQGWKYFKGNFYYFSLIPKTWYSAEQFCVSRNSHLTSVTSESEQE
FLYKTAGGFIYWIGLTKAGMEGDWSWVDDTPFNKVQSARFWIPGEPNNAGNNEHCGNIKA
LSLQAWNDAPCDKTFLFICKRPYVPSEP
Download sequence
Identical sequences G1RGW2
XP_003262574.1.23891 ENSNLEP00000012462 ENSNLEP00000012462

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]