SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000012479 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000012479
Domain Number 1 Region: 551-689,736-909
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.07e-78
Family Protein kinases, catalytic subunit 0.00000000307
Further Details:      
 
Domain Number 2 Region: 202-296
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000397
Family C1 set domains (antibody constant domain-like) 0.066
Further Details:      
 
Domain Number 3 Region: 21-106
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000625
Family V set domains (antibody variable domain-like) 0.064
Further Details:      
 
Domain Number 4 Region: 400-495
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000126
Family I set domains 0.042
Further Details:      
 
Domain Number 5 Region: 311-406
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000163
Family I set domains 0.057
Further Details:      
 
Domain Number 6 Region: 97-193
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000188
Family I set domains 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000012479   Gene: ENSNLEG00000010225   Transcript: ENSNLET00000013090
Sequence length 976
Comment pep:known_by_projection supercontig:Nleu1.0:GL397305.1:17750256:17914010:-1 gene:ENSNLEG00000010225 transcript:ENSNLET00000013090 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPGVLLLLLVATAWHGQGIPVIEPSGPELVVKPGATVSLRCVGNGSVEWDGPLSPHWTL
YSDGSSSILATNNATFQNTGTYRCTEPGDSLGGSAAIHLYVKDPARPWNVLAEEVIVFED
QDALLPCLLTDPVLEAGVSLVRVRGRPLMRHTNYSFSPWHGFTIHRAKFIQSQDYQCSAL
MGGRKVMSISIRLKVQKVIPGPPALTLAPAELVRIRGEAAQIVCSASNVDVNFDVFLQHD
NTKLAIPQQSDFHNNRYQKVLTLSLDQVDFQHAGNYSCMASNVQGKHSTSMFFRVVESAY
LNLSSEQNLIQEVTVGEGLNLKVMVEAYPGLQGFNWTYLGPFSDHQPEPKLANATTKDTY
RHTFTLSLPRLKPSEAGRYSFLARNPGGWRALTFELTLRYPPEVSVIWTFINGSGTLLCA
ASGYPQPNVTWLQCSGHTDRCDEAQVLQVWDDPYPEVLSQAPFHKVTVQSLLTVETFRAQ
PNYECRAHNSVGSGSWAFIPISAGARTHPPDEFLFTPVVVACMSVMALLLLLLLLLLYKY
KQKPKYQVRWKIIESYEGNSYTFIDPTQLPYNEKWEFPRNNLQFGKTLGAGAFGKVVEAT
AFGLGKEDAVLKVAVKMLSATAHADEKEALMSELKIMSHLGQHENIVNLLGACTHGGPVL
VITEYCCYGDLLNFLRRKAEAMLGPSLSPGQDPEGGADYKNIHLEKKYVRRDSGFSSQGV
DTYVEMRPVSTSSNDFFSEQDLDKEDGRPLELRDLLHFSSQVAQGMAFLASKNCIHRDVA
ARNVLLTSGHVAKIGDFGLARDIMNDSNYIVKGNARLPVKWMAPESIFDCVYTVQSDVWS
YGILLWEIFSLGLNPYPGILVNSKFYKLVKDGYQMAQPAFAPKNIYSIMQACWALEPTHR
PTFQQICSFLQEQAQEDRRERDYTNLPSSTRRGGSGRGSGSSSSELEEESSSEHLTCCEQ
GDIAQPLLQPNNYQFC
Download sequence
Identical sequences ENSNLEP00000012479 ENSNLEP00000012479

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]