SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000012499 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000012499
Domain Number 1 Region: 572-707,784-956
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.63e-79
Family Protein kinases, catalytic subunit 0.0000000228
Further Details:      
 
Domain Number 2 Region: 223-312
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000013
Family I set domains 0.075
Further Details:      
 
Domain Number 3 Region: 330-415
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000217
Family I set domains 0.035
Further Details:      
 
Domain Number 4 Region: 34-111
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000254
Family I set domains 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000012499   Gene: ENSNLEG00000010243   Transcript: ENSNLET00000013110
Sequence length 1106
Comment pep:known_by_projection supercontig:Nleu1.0:GL397305.1:17811515:17853352:-1 gene:ENSNLEG00000010243 transcript:ENSNLET00000013110 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLPGAMPALALKGQLLLLPLLLLLEPHVSQGLVITPPGPELVLNVSSTFVLTCSGSAPV
VWERMSQEPPQEMAKAQDGTFSSVLTLTNLTGLDTGEYFCTHNDSRGLEPDERKRLYIFV
PDPTVGFLPNDAEELFIFLTEITEITIPCRVTDPQLVVTLHEKKGDIALPVPYDYQRGFS
GIFEDRSYICKTTIGDREVDSDAYYVYRLQVSSINVSVNAVQTVVRQGENITLMCIVIGN
EVVNFEWTYPRKESGRLVEPVTDFLLDMPYHIRSILHIPSAELEDSGTYTCNVTESVNDH
QDEKAINITVVESGYVRLLGEVGTLQFAELHRSRTLQVVFEAYPPPTVLWFKDNRTLGDS
SAGEIALSTRNMSETRYVSELTLVRVKVAEAGHYTMRAFHEDAEVQLSFQLQINVPVRVL
ELSESHPDSGEQTVRCRGRGMPQPNIIWSACRDLKRCPRELPPMLLGNSSEEESQLETNV
TYWEEEQEFEVVSTLRLQHVDRPLSVRCTLRNAVGQDTQEVIVVPHSLPFKVVVISAILA
LVVLTIISLIILIMLWQKKPRYEIRWKVIESVSSDGHEYIYVDPMQLPYDSTWELPRDQL
VLGRTLGSGAFGQVVEATAHGLSHSQATMKVAVKMLKSTARSSEKQALMSELKIMSHLGP
HLNVVNLLGACTKGGPIYIITEYCRYGDLVDYLHRNKHTFLQHHSDKRRPPSAELYSNAL
PVGLPLPSHVSLTGESDGGYMDMSKDESVDYVPMLDMKGDVKYADIESSNYMAPYDNYVP
SAPERTCRATLINESPVLSYMDLVGFSYQVANGMEFLASKNCVHRDLAARNVLICEGKLV
KICDFGLARDIMRDSNYISKGSTFLPLKWMAPESIFNSLYTTLSDVWSFGILLWEIFTLG
GTPYPELPMNEQFYNAIKRGYRMAQPAHASDEIYEIMQKCWEEKFEIRPPFSQLVLLLER
LLGEGYKKKYQQVDEEFLRSDHPAILRSQARLPGFHGLRSPLDTSSVLYTAVQPNEGDND
YIIPLPDPKPEVADEGPLEGSPSLASSTLNEVNTSSTISCDSPLEPQEEPEPEPQLELQV
EPEPELEQLPDSGCPAPRAEAEDSFL
Download sequence
Identical sequences G1RGZ9
ENSNLEP00000012499 XP_003266678.1.23891 XP_012360447.1.23891 ENSNLEP00000012499

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]