SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000012535 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000012535
Domain Number 1 Region: 186-287
Classification Level Classification E-value
Superfamily Immunoglobulin 6.99e-29
Family C1 set domains (antibody constant domain-like) 0.0004
Further Details:      
 
Domain Number 2 Region: 83-180
Classification Level Classification E-value
Superfamily Immunoglobulin 3.63e-24
Family C1 set domains (antibody constant domain-like) 0.0017
Further Details:      
 
Domain Number 3 Region: 3-68
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000404
Family C1 set domains (antibody constant domain-like) 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000012535   Gene: ENSNLEG00000010294   Transcript: ENSNLET00000013147
Sequence length 333
Comment pep:known_by_projection supercontig:Nleu1.0:GL397565.1:145052:148565:-1 gene:ENSNLEG00000010294 transcript:ENSNLET00000013147 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RQIQVSWLREGKQVGSGITTDQVQAEDKESGPTTFKVTSTLTIIESDWLSQNTFTCRVDH
RGLTFQKNASSMCSPNPDTAIRVFAIPPSFASIFLSKSTKLTCLVTDLTSYDSVTISWTR
QNGEAVKTHTNISESHPNATFSAVGEASICEDDWNSGESFTCTVTHTDLPSPLKQTISRP
KGVALHRPDVYLLPPAREQLNLRESATITCLVTGFSPADVFVQWMQRGQPLPEEKYVTSA
PVPEPQAPGRYFAHSILTVSEEDWNTGETYTCVVAHEALPNRVTERTVDKSTEGEVSADE
EGFENLWATASTFIVLFLLSLFYSTTVTLFKVA
Download sequence
Identical sequences ENSNLEP00000012535 ENSNLEP00000012535

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]